KEGG   Mus musculus (mouse): 13649
Entry
13649             CDS       T01002                                 

Gene name
Egfr, 9030024J15Rik, AI552599, Erb, Erbb, Err, Errb1, Errp, Wa, Wa5, wa-2, wa2
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13649 (Egfr)
   04012 ErbB signaling pathway
    13649 (Egfr)
   04014 Ras signaling pathway
    13649 (Egfr)
   04015 Rap1 signaling pathway
    13649 (Egfr)
   04630 JAK-STAT signaling pathway
    13649 (Egfr)
   04066 HIF-1 signaling pathway
    13649 (Egfr)
   04068 FoxO signaling pathway
    13649 (Egfr)
   04020 Calcium signaling pathway
    13649 (Egfr)
   04072 Phospholipase D signaling pathway
    13649 (Egfr)
   04151 PI3K-Akt signaling pathway
    13649 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    13649 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13649 (Egfr)
   04520 Adherens junction
    13649 (Egfr)
   04540 Gap junction
    13649 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    13649 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    13649 (Egfr)
   04915 Estrogen signaling pathway
    13649 (Egfr)
   04921 Oxytocin signaling pathway
    13649 (Egfr)
   04926 Relaxin signaling pathway
    13649 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    13649 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13649 (Egfr)
   05206 MicroRNAs in cancer
    13649 (Egfr)
   05205 Proteoglycans in cancer
    13649 (Egfr)
   05230 Central carbon metabolism in cancer
    13649 (Egfr)
   05231 Choline metabolism in cancer
    13649 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13649 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13649 (Egfr)
   05212 Pancreatic cancer
    13649 (Egfr)
   05225 Hepatocellular carcinoma
    13649 (Egfr)
   05226 Gastric cancer
    13649 (Egfr)
   05214 Glioma
    13649 (Egfr)
   05218 Melanoma
    13649 (Egfr)
   05219 Bladder cancer
    13649 (Egfr)
   05215 Prostate cancer
    13649 (Egfr)
   05213 Endometrial cancer
    13649 (Egfr)
   05224 Breast cancer
    13649 (Egfr)
   05223 Non-small cell lung cancer
    13649 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    13649 (Egfr)
   05171 Coronavirus disease - COVID-19
    13649 (Egfr)
   05163 Human cytomegalovirus infection
    13649 (Egfr)
   05165 Human papillomavirus infection
    13649 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    13649 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13649 (Egfr)
   01522 Endocrine resistance
    13649 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13649 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13649 (Egfr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13649 (Egfr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13649 (Egfr)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   13649 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   13649 (Egfr)
  Exosomal proteins of bladder cancer cells
   13649 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like ABC1
Other DBs
NCBI-GeneID: 13649
NCBI-ProteinID: NP_997538
MGI: 95294
Ensembl: ENSMUSG00000020122
Vega: OTTMUSG00000005185
UniProt: Q01279 Q9WVF5 Q9EP98 Q3TQS6
Position
11 A2; 11 9.41 cM
AA seq 1210 aa
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTED
NIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctcagggaccgcgagaaccacactgctggtgttgctgaccgcgctctgcgcc
gcaggtggggcgttggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaggaattacgacctttccttcttaaag
accatccaggaggtggccggctatgtcctcattgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctttatgaaaacacctatgccttagcc
atcctgtccaactatgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggat
actatccagtggagggacatcgtccaaaacgtctttatgagcaacatgtcaatggactta
cagagccatccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggaggaggagaggagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
catcgctgtcgtggcaggtcccccagtgactgctgccacaaccaatgtgctgcggggtgt
acagggccccgagagagtgactgtctggtctgccaaaagttccaagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccccaccacctatcagatggatgtcaac
cctgaagggaagtacagctttggtgccacctgtgtgaagaagtgcccccgaaactacgtg
gtgacagatcatggctcatgtgtccgagcctgtgggcctgactactacgaagtggaagaa
gatggcatccgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaaa
tactgcactgccatcagcggggaccttcacatcctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctagacccacgagaactagaaattctaaaaaccgtaaaggaa
ataacaggctttttgctgattcaggcttggcctgataactggactgacctccatgctttc
gagaacctagaaataatacgtggcagaacaaagcaacatggtcagttttctttggcggtc
gttggcctgaacatcacatcactggggctgcgttccctcaaggagatcagtgatggggat
gtgatcatttctggaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcatgaacaacagagctgagaaagactgcaag
gccgtgaaccacgtctgcaatcctttatgctcctcggaaggctgctggggccctgagccc
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggagaaatgcaac
atcctggagggggaaccaagggagtttgtggaaaattctgaatgcatccagtgccatcca
gaatgtctgccccaggccatgaacatcacctgtacaggcaggggaccagacaactgcatc
cagtgtgcccactacattgatggcccacactgtgtcaagacctgcccagctggcatcatg
ggagagaacaacactctggtctggaagtatgcagatgccaataatgtctgccacctatgc
cacgccaactgtacctatggatgtgctgggccaggtcttcaaggatgtgaagtgtggcca
tctgggccaaagataccatctattgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttgggattggcctattcatgcgaagacgtcacattgttcgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcgggagcatttggcacagtgtataagggtctctggatcccagaaggtgagaaagta
aaaatcccggtggccatcaaggagttaagagaagccacatctccaaaagccaacaaagaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtatgccgcctcctg
ggcatctgtctgacctccactgtccagctcattacacagctcatgccctacggttgcctc
ctggactacgtccgagaacacaaggacaacattggctcccagtacctcctcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgcttggtgctgaagagaaagaatatcatgccgaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacaccgaatttatacacaccaaagtgatgtctgg
agctatggtgtcactgtgtgggaactgatgacctttgggtccaagccttatgatggaatc
ccagcaagtgacatctcatccatcctagagaaaggagagcgccttccacagccacctatc
tgcaccatcgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgc
ccaaagttccgagagttgattcttgaattctccaaaatggcccgagacccacagcgctac
cttgttatccagggggatgaaagaatgcatttgccaagccctacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccgtccacgtcgaggactcccctcttgagttctctg
agtgcaactagcaacaattccactgtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacgccttcttgcagcggtacagctccgaccccacaggtgctgtaacagaggac
aacatagatgacgcattcctccctgtacctgaatatgtaaaccaatctgttcccaagagg
ccagcaggctctgtgcagaaccctgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccacagcaatgcagtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcactctggatccagaaa
ggcagtcaccaaatgagcctagacaaccctgactaccagcaggacttcttccccaaggaa
accaagccaaatggcatatttaagggccccacagctgaaaatgcagagtacctacgggtg
gcacctccaagcagtgagtttattggagcatga

KEGG   Mus musculus (mouse): 13866
Entry
13866             CDS       T01002                                 

Gene name
Erbb2, ErbB-, Erbb-2, HER, HER-, HER-2, HER2, Ne, Neu, c-erbB, c-erbB2, c-ne, c-neu, l11Ju, l11Jus8, mKIAA3023
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13866 (Erbb2)
   04012 ErbB signaling pathway
    13866 (Erbb2)
   04066 HIF-1 signaling pathway
    13866 (Erbb2)
   04020 Calcium signaling pathway
    13866 (Erbb2)
   04151 PI3K-Akt signaling pathway
    13866 (Erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13866 (Erbb2)
   04520 Adherens junction
    13866 (Erbb2)
   04530 Tight junction
    13866 (Erbb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13866 (Erbb2)
   05206 MicroRNAs in cancer
    13866 (Erbb2)
   05205 Proteoglycans in cancer
    13866 (Erbb2)
   05230 Central carbon metabolism in cancer
    13866 (Erbb2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    13866 (Erbb2)
   05226 Gastric cancer
    13866 (Erbb2)
   05219 Bladder cancer
    13866 (Erbb2)
   05215 Prostate cancer
    13866 (Erbb2)
   05213 Endometrial cancer
    13866 (Erbb2)
   05224 Breast cancer
    13866 (Erbb2)
   05223 Non-small cell lung cancer
    13866 (Erbb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13866 (Erbb2)
   01524 Platinum drug resistance
    13866 (Erbb2)
   01522 Endocrine resistance
    13866 (Erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13866 (Erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13866 (Erbb2)
   04090 CD molecules [BR:mmu04090]
    13866 (Erbb2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13866 (Erbb2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13866 (Erbb2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   13866 (Erbb2)
CD molecules [BR:mmu04090]
 Proteins
  13866 (Erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Haspin_kinase DUF5849 Kinase-like GAPT
Other DBs
NCBI-GeneID: 13866
NCBI-ProteinID: NP_001003817
MGI: 95410
Ensembl: ENSMUSG00000062312
Vega: OTTMUSG00000002711
UniProt: P70424
Position
11 61.75 cM; 11 D
AA seq 1256 aa
MELAAWCRWGFLLALLSPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYMLIAHNRVKHVPLQRLRIVRGTQLFEDKYALAVLDNR
DPLDNVTTAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVLRKNNQL
APVDMDTNRSRACPPCAPTCKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQ
CAAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVTTC
PYNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCAGVCYGLGMEHLRGARAITSD
NIQEFAGCKKIFGSLAFLPESFDGNPSSGVAPLKPEHLQVFETLEEITGYLYISAWPESF
QDLSVFQNLRVIRGRILHDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVNT
VPWDQLFRNPHQALLHSGNRPEEACGLEGLVCNSLCARGHCWGPGPTQCVNCSQFLRGQE
CVEECRVWKGLPREYVRGKHCLPCHPECQPQNSSETCYGSEADQCEACAHYKDSSSCVAR
CPSGVKPDLSYMPIWKYPDEEGICQPCPINCTHSCVDLDERGCPAEQRASPVTFIIATVV
GVLLFLIIVVVIGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAVPNQAQMRILKETE
LRKLKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGS
PYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEV
RLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRF
THQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCW
MIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPSSPMDSTFYRSLLEDDDMGELVD
AEEYLVPQQGFFSPDPALGTGSTAHRRHRSSSARSGGGELTLGLEPSEEEPPRSPLAPSE
GAGSDVFDGDLAVGVTKGLQSLSPHDLSPLQRYSEDPTLPLPPETDGYVAPLACSPQPEY
VNQPEVRPQSPLTPEGPPPPIRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAP
RAGTASQPHPSPAFSPAFDNLYYWDQNSSEQGPPPSTFEGTPTAENPEYLGLDVPV
NT seq 3771 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgttgggggttcctcctcgccctcctgtcccccggagcc
gcgggtacccaagtgtgtaccggtaccgacatgaagttgcgactccctgccagtcctgag
acccacctggacatgcttcgccacctctaccagggctgtcaggtggtgcagggcaatttg
gagcttacctacctgcccgccaatgccagcctctcattcctgcaggacatccaggaagtc
cagggatacatgctcatcgctcacaaccgagtgaaacacgtcccactgcagaggttgcgc
atcgtgagagggactcagctctttgaggacaagtatgccctggctgtgctagacaaccga
gaccctttggacaacgtcaccaccgccgccccaggcagaaccccagaagggctgcgggag
ctgcagcttcgaagtctcacagagatcttgaagggaggagttttgatccgtgggaaccct
cagctctgctaccaggacatggttttgtggaaggatgtcctccgtaagaataaccagctg
gctcctgtcgacatggacaccaatcgttcccgggcctgtccaccttgtgccccaacctgc
aaagacaatcactgttggggtgagagtcctgaagactgtcagatcttgactggcaccatc
tgtactagtggctgtgcccggtgcaagggccggctgcccactgactgttgccatgagcag
tgtgctgcaggctgcacgggtcccaagcattctgactgcctggcctgcctccacttcaat
catagtggtatctgtgagctgcactgcccggccctcatcacctacaacacagacaccttc
gagtccatgctcaaccctgagggtcgctacacctttggtgccagctgtgtgaccacctgc
ccctacaactacctctccacggaagtgggatcctgcactctggtctgtcccccgaacaac
caagaggtcacagctgaggacggaacacagcggtgtgagaaatgcagcaagccctgtgct
ggagtatgctatggtctgggcatggagcacctccgaggggcgagggccatcaccagtgac
aatatccaggagtttgctggctgcaagaagatctttgggagcctggcatttttgccggag
agctttgatgggaacccctcctccggcgttgccccactgaagccagagcatctccaagtg
ttcgaaaccctggaggagatcacaggttacctatacatttcagcatggccagagagcttc
caagacctcagtgtcttccagaaccttcgggtcattcggggacggattctccatgatggt
gcttactcattgacgttgcaaggcctggggattcactcactggggctacgctcactgcgg
gagctgggcagtggattggctctcattcaccgcaacacccatctctgctttgtaaacact
gtaccttgggaccagctcttccggaacccgcaccaggccctactccacagtgggaaccgg
ccagaagaggcatgtggtcttgagggcttggtctgtaactcactgtgtgcccgtgggcac
tgctgggggccagggcccacccagtgtgtcaactgcagtcagttcctccggggccaggag
tgtgtggaggagtgccgagtatggaaggggctccccagggagtatgtgaggggcaagcac
tgtctgccatgccaccccgagtgtcagcctcaaaacagctcggagacctgctatggatcg
gaggctgaccagtgtgaggcttgtgcccactacaaggactcatcttcctgtgtggctcgc
tgccccagtggtgtgaagccagacctctcctacatgcctatctggaagtacccggatgag
gagggcatatgtcagccatgccccatcaactgcacccactcatgtgtggacctggacgaa
cgaggctgcccagcagagcagagagccagcccagtgacattcatcattgcaactgtggtg
ggcgtcctgttgttcctgatcatagtggtggtcattggaatcctaatcaaacgaaggcga
cagaagatccggaagtataccatgcgtaggctgctgcaggagaccgagctggtggagccg
ctgacgcccagtggagctgtgcccaaccaggctcagatgcggatcctaaaggagacagag
ctaaggaagctgaaggtgcttgggtcaggagccttcggcactgtctacaagggcatctgg
atcccagatggggagaacgtgaaaatccccgtggccatcaaggtgttgagggaaaacaca
tctcctaaagctaacaaagaaatcctagatgaagcgtacgtcatggctggtgtgggttct
ccatatgtgtcccgcctcctgggcatctgcctgacatccacagtgcagctggtgacacag
cttatgccctatggctgccttctggaccatgtccgagaacaccgaggtcgcttaggctcc
caggacctgctcaactggtgtgttcagattgccaaggggatgagctacctggaggaagtt
cggcttgttcacagggacctagctgcccgaaacgtgctagtcaagagtcccaaccacgtc
aagattaccgacttcgggctggcacggctgctggacattgatgagactgaataccatgca
gatgggggcaaggtgcccatcaagtggatggcattggaatctattctcagacgccggttc
acccatcagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacctttggg
gccaaaccttacgatgggatcccagctcgggagatccctgatttgctggagaagggagaa
cgcctacctcagcctccaatctgcaccatcgacgtctacatgatcatggtcaaatgttgg
atgattgactccgaatgtcgcccgagattccgggagttggtatcagaattctcccgtatg
gcaagggacccccagcgctttgtggtcatccagaacgaggacttaggcccctccagcccc
atggacagcaccttctaccgttcactgctggaggatgatgacatgggggagctggtcgat
gctgaagagtacctggtaccccagcagggattcttctccccagaccctgccctaggtact
gggagcacagcccaccgcagacaccgcagctcgtcggccaggagtggcggtggtgagctg
acactgggcctggagccctcggaagaagagccccccagatctccactggctccctccgaa
ggggctggctccgatgtgtttgatggtgacctggcagtgggggtaaccaaaggactgcag
agcctctctccacatgacctcagccctctacagcggtacagtgaggatcccacattacct
ctgccccccgagactgatggctacgttgctcccctggcctgcagcccccagcccgagtat
gtgaaccagccagaggttcggcctcagtctcccttgaccccagagggtcctccgcctccc
atccgacctgctggtgctactctagaaagacccaagactctctctcctgggaaaaatggg
gttgtcaaagacgtttttgcctttgggggtgctgtggagaaccctgaatacttagcaccc
agagcaggcactgcctctcagccccacccttctcctgccttcagcccagcctttgacaac
ctctattactgggaccagaactcatcggagcagggtcctccaccaagtacctttgaaggg
acccccactgcagagaaccctgagtacctaggcctggatgtgccagtatga

KEGG   Mus musculus (mouse): 14182
Entry
14182             CDS       T01002                                 

Gene name
Fgfr1, AW208770, Ea, Eask, FGFR, FGFR-I, FLG, Fgfr-, Fgfr-1, Flt-, Flt-2, Fr, Fr1, Hs, Hspy, MFR, bFGF-R-1, c-fgr
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04714  Thermogenesis
mmu04810  Regulation of actin cytoskeleton
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14182 (Fgfr1)
   04014 Ras signaling pathway
    14182 (Fgfr1)
   04015 Rap1 signaling pathway
    14182 (Fgfr1)
   04020 Calcium signaling pathway
    14182 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    14182 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    14182 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    14182 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14182 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    14182 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    14182 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14182 (Fgfr1)
   05205 Proteoglycans in cancer
    14182 (Fgfr1)
   05230 Central carbon metabolism in cancer
    14182 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    14182 (Fgfr1)
   05215 Prostate cancer
    14182 (Fgfr1)
   05224 Breast cancer
    14182 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14182 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14182 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14182 (Fgfr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14182 (Fgfr1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14182 (Fgfr1)
CD molecules [BR:mmu04090]
 Proteins
  14182 (Fgfr1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14182 (Fgfr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_5 C2-set_2 Ig_4 ABC1 Pkinase_fungal TCAD9 DUF1615 DUF4611
Other DBs
NCBI-GeneID: 14182
NCBI-ProteinID: NP_034336
MGI: 95522
Ensembl: ENSMUSG00000031565
Vega: OTTMUSG00000031031
UniProt: P16092 Q8CBY7
Structure
PDB: 
2CKN

Position
8 A2; 8 14.12 cM
AA seq 822 aa
MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtggggctggaagtgcctcctcttctgggctgtgctggtcacagccactctctgcact
gccaggccagccccaaccttgcctgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggcgacctgctacagcttcgctgtcggcttcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggtggagagcaaccgtacccgc
atcacaggggaggaggtggaggtgcgggactccatccccgctgactctggcctctacgct
tgcgtgaccagcagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactcccatcctcggaagatgatgacgacgacgatgactcctcctcggaggagaaagag
acggacaacaccaaaccaaaccgtaggcctgtagctccctactggacatccccagagaaa
atggagaagaaactgcatgcggtgcccgctgccaagacggtgaagttcaagtgcccgtcg
agtgggacacccaaccccactctgcgctggttgaaaaatggcaaagagtttaagcctgac
caccgaattggaggctacaaggttcgctatgccacctggagcatcataatggattctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaatgagtatgggagcatcaac
cacacctaccagcttgacgtcgtggaacgatctccgcaccgacccatccttcaggcaggg
ctgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agcgatccgcagcctcacattcagtggctgaagcacatcgaggtgaacgggagtaagatc
gggccagacaacttgccgtatgtccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagaccagctgtgatgacctcaccgctctacctggagatcattatctac
tgcaccggggccttcctgatctcctgcatgttgggctctgtcatcatctataagatgaag
agcggcaccaagaagagcgacttccatagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtcagctgactccagtgcatccatgaactctggg
gttctcctggttcggccctcacggctctcctccagcgggacccccatgctggctggagtc
tccgaatatgagctccctgaggatccccgctgggagctgccacgagacagactggtctta
ggcaaaccacttggcgagggctgcttcgggcaggtggtgttggctgaggccatcgggctg
gataaggacaaacccaaccgtgtgaccaaagtggccgtgaagatgttgaagtccgacgca
acggagaaggacctgtcggatctgatctcggagatggagatgatgaaaatgattgggaag
cacaagaatatcatcaaccttctgggagcgtgcacacaggatggtcctctttatgtcatt
gtggagtacgcctccaaaggcaatctccgggagtatctacaggcccggaggcctcctggg
ctggagtactgctataaccccagccacaaccccgaggaacagctgtcttccaaagatctg
gtatcctgtgcctatcaggtggctcggggcatggagtatcttgcctctaagaagtgtata
caccgagacctggctgctaggaacgtcctggtgaccgaggataacgtaatgaagatcgca
gactttggcttagctcgagacattcatcatatcgactactacaagaaaaccaccaacggc
cggctgcctgtgaagtggatggcccctgaggcgttgtttgaccggatctacacacaccag
agcgatgtgtggtcttttggagtgctcttgtgggagatcttcactctgggtggctcccca
taccccggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcatcgaatggac
aagcccagtaactgtaccaatgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctctcagagacctacgttcaagcagttggtggaagacctggaccgcattgtggccttg
acctccaaccaggagtatctggacctgtccataccgctggaccagtactcacccagcttt
cccgacacacggagctccacctgctcctcaggggaggactctgtcttctctcatgagccg
ttacctgaggagccctgtctgcctcgacaccccacccagcttgccaacagtggactcaaa
cggcgctga

KEGG   Mus musculus (mouse): 14183
Entry
14183             CDS       T01002                                 

Gene name
Fgfr2, AU043015, AW556123, Bek, Fgfr, Fgfr-, Fgfr-2, Fgfr-7, Fgfr2b, Fgfr7, KGFR, KGFRTr, svs
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14183 (Fgfr2)
   04014 Ras signaling pathway
    14183 (Fgfr2)
   04015 Rap1 signaling pathway
    14183 (Fgfr2)
   04020 Calcium signaling pathway
    14183 (Fgfr2)
   04151 PI3K-Akt signaling pathway
    14183 (Fgfr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14183 (Fgfr2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14183 (Fgfr2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14183 (Fgfr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14183 (Fgfr2)
   05230 Central carbon metabolism in cancer
    14183 (Fgfr2)
  09162 Cancer: specific types
   05226 Gastric cancer
    14183 (Fgfr2)
   05215 Prostate cancer
    14183 (Fgfr2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14183 (Fgfr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14183 (Fgfr2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14183 (Fgfr2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14183 (Fgfr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14183 (Fgfr2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14183 (Fgfr2)
CD molecules [BR:mmu04090]
 Proteins
  14183 (Fgfr2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14183 (Fgfr2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set Ig_5 ABC1 Ig_4 C2-set_2 Kinase-like FAM176 Pkinase_fungal
Other DBs
NCBI-GeneID: 14183
NCBI-ProteinID: NP_034337
MGI: 95523
Ensembl: ENSMUSG00000030849
Vega: OTTMUSG00000031222
UniProt: P21803 E9QK53
Structure
PDB: 
4HWU

Position
7; 7 F3
AA seq 840 aa
MGLPSTWRYGRGPGIGTVTMVSWGRFICLVLVTMATLSLARPSFSLVEDTTLEPEEPPTK
YQISQPEAYVVAPGESLELQCMLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACTAARTVDSETWYFMVNVTDAISSGDDEDDTDSSEDVVSENRSNQRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCLVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYT
CLAGNSIGISFHSAWLTVLPAPVREKEITASPDYLEIAIYCIGVFLIACMVVTVIFCRMK
TTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLA
GVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKD
DATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRP
PGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMK
IADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGG
SPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIL
TLTTNEEYLDLTQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgggattaccgtccacgtggagatatggaagaggaccagggattggcactgtgaccatg
gtcagctgggggcgcttcatctgcctggtcttggtcaccatggcaaccttgtccctggcc
cggccctccttcagtttagttgaggataccactttagaaccagaagagccaccaaccaaa
taccaaatctcccaaccagaagcgtacgtggttgcccccggggaatcgctagagttgcag
tgcatgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttggggccc
aacaataggacagtgcttattggggagtatctccagataaaaggtgccacacctagagac
tccggcctctatgcttgtactgcagctaggacggtagacagtgaaacttggtacttcatg
gtgaatgtcacagatgccatctcatctggagatgatgaggacgacacagatagctccgaa
gacgttgtcagtgagaacaggagcaaccagagagcaccgtactggaccaacaccgagaag
atggagaagcggctccacgctgtccctgccgccaacactgtgaagttccgctgtccggct
ggggggaatccaacgcccacaatgaggtggttaaaaaacgggaaggagtttaagcaggag
catcgcattggaggctataaggtacgaaaccagcactggagccttattatggaaagtgtg
gtcccgtcagacaaaggcaactacacctgcctggtggagaatgaatacgggtccatcaac
cacacctaccacctcgatgtcgttgaacggtcaccacaccggcccatcctccaagctgga
ctgcctgcaaatgcctccacggtggtcggaggggatgtggagtttgtctgcaaggtttac
agcgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaatac
gggcctgatgggctgccctacctcaaggtcctgaaggccgccggtgttaacaccacggac
aaagagattgaggttctctatattcggaatgtaacttttgaggatgctggggaatatacg
tgcttggcgggtaattctatcgggatatcctttcactctgcatggttgacagttctgcca
gcgcctgtgagagagaaggagatcacggcttccccagattatctggagatagctatttac
tgcataggggtcttcttaatcgcctgcatggtggtgacagtcatcttttgccgaatgaag
accacgaccaagaagccagacttcagcagccagccagctgtgcacaagctgaccaagcgc
atccccctgcggagacaggtaacagtttcggccgagtccagctcctccatgaactccaac
accccgctggtgaggataacaacgcgtctgtcctcaacagcggacaccccgatgctagca
ggggtctccgagtatgagttgccagaggatccaaagtgggaattccccagagataagctg
acgctgggcaaacccctgggggaaggttgcttcgggcaagtagtcatggctgaagcagtg
ggaatcgataaagacaaacccaaggaggcggtcaccgtggcagtgaagatgttgaaagat
gatgccacagagaaggacctgtctgatctggtatcagagatggagatgatgaagatgatt
gggaaacataagaacattatcaacctcctgggggcctgcacgcaggatggacctctctac
gtcatagttgaatatgcatcgaaaggcaacctccgggaatacctccgagcccggaggcca
cctggcatggagtactcctatgacattaaccgtgtccccgaggagcagatgaccttcaag
gacttggtgtcctgcacctaccagctggctagaggcatggagtacttggcttcccaaaaa
tgtatccatcgagatttggctgccagaaacgtgttggtaacagaaaacaatgtgatgaag
atagcagactttggcctggccagggatatcaacaacatagactactataaaaagaccaca
aatgggcgacttccagtcaagtggatggctcctgaagccctttttgatagagtttacact
catcagagcgatgtctggtccttcggggtgttaatgtgggagatctttactttagggggc
tcaccctacccagggattcccgtggaggaactttttaagctgctcaaagagggacacagg
atggacaagcccaccaactgcaccaatgaactgtacatgatgatgagggattgctggcat
gctgtaccctcacagagacccacattcaagcagttggtcgaagacttggatcgaattctg
actctcacaaccaatgaggaatacttggatctcacccagcctctcgaacagtattctcct
agttaccccgacacaaggagctcttgttcttcaggggacgattctgtgttttctccagac
cccatgccttatgaaccctgtctgcctcagtatccacacataaacggcagtgttaaaaca
tga

KEGG   Mus musculus (mouse): 16001
Entry
16001             CDS       T01002                                 

Gene name
Igf1r, A330103N21Rik, CD221, D930020L01, IGF-, IGF-1R, hyft
Definition
(RefSeq) insulin-like growth factor I receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04144  Endocytosis
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04730  Long-term depression
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16001 (Igf1r)
   04014 Ras signaling pathway
    16001 (Igf1r)
   04015 Rap1 signaling pathway
    16001 (Igf1r)
   04066 HIF-1 signaling pathway
    16001 (Igf1r)
   04068 FoxO signaling pathway
    16001 (Igf1r)
   04151 PI3K-Akt signaling pathway
    16001 (Igf1r)
   04152 AMPK signaling pathway
    16001 (Igf1r)
   04150 mTOR signaling pathway
    16001 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16001 (Igf1r)
   04140 Autophagy - animal
    16001 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    16001 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16001 (Igf1r)
   04520 Adherens junction
    16001 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    16001 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    16001 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    16001 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    16001 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    16001 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    16001 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16001 (Igf1r)
   05202 Transcriptional misregulation in cancer
    16001 (Igf1r)
   05205 Proteoglycans in cancer
    16001 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    16001 (Igf1r)
   05214 Glioma
    16001 (Igf1r)
   05218 Melanoma
    16001 (Igf1r)
   05215 Prostate cancer
    16001 (Igf1r)
   05224 Breast cancer
    16001 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16001 (Igf1r)
   01522 Endocrine resistance
    16001 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16001 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16001 (Igf1r)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16001 (Igf1r)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   16001 (Igf1r)
CD molecules [BR:mmu04090]
 Proteins
  16001 (Igf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD B2 DUF4476
Other DBs
NCBI-GeneID: 16001
NCBI-ProteinID: NP_034643
MGI: 96433
Ensembl: ENSMUSG00000005533
Vega: OTTMUSG00000059602
UniProt: Q60751 E9QNX9
Structure
PDB: 
6PYH

Position
7 C; 7 37.27 cM
AA seq 1369 aa
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGD
LCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHD
DECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLYR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERRRRDVMQVANTTMSSRSRNTTVADTYNITDPEEFETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAA
RNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSF
GVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPS
FLEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMEPENMESVPLDPSASSASLPLPE
RHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctctctctggccgacgagtggagaaatctgtgggcccggcattgacatccgc
aacgactatcagcagctgaagcgcctggaaaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgaagctaccgcttccccaagctcaccgtc
atcactgagtacttgctgctcttccgagtcgctggcctcgagagcctgggagacctcttc
cccaacctcacagtcatccgtggctggaaactcttctacaactacgcactggtcatcttc
gagatgaccaatctcaaggatattgggctttataatctgaggaacattactcggggggcc
atcaggattgagaagaacgccgacctctgttacctctccaccatagactggtctctcatc
ttggatgcggtgtccaataactacattgtggggaacaagcccccgaaggaatgtggggac
ctgtgtccagggacattggaggagaagcccatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaatcgctgccagaaaatgtgcccaagtgtgtgcggg
aagcgagcctgcaccgagaacaacgagtgctgccacccggagtgcctgggcagctgccac
acaccggacgacaacacaacctgcgtggcctgcagacactactactacaaaggcgtgtgt
gtgcctgcctgcccgcctggcacctacaggttcgagggctggcgctgtgtggatcgcgat
ttctgcgccaacatccccaacgctgagagcagtgactcggatggcttcgttatccacgac
gatgagtgcatgcaggagtgtccctcaggcttcatccgcaacagcacccagagcatgtac
tgtatcccctgcgaaggcccctgccccaaagtctgcggcgatgaagagaagaaaacgaaa
accatcgattcggtgacttctgctcaaatgctccaaggatgcaccatcctgaagggcaat
ctgcttattaacatccggagaggcaataacattgcctcggagttggagaacttcatgggg
ctcatcgaggtggtgaccggctacgtgaagatccgccattctcatgccttggtctccttg
tccttcctgaagaaccttcgtctcatcttaggagaggagcagctggaagggaactactcc
ttctatgtcctagacaaccagaacttgcagcagctgtgggactggaaccaccggaacctg
accgtcaggtccggaaagatgtactttgctttcaatcccaagctgtgtgtctccgaaatt
taccgcatggaggaagtgaccggaaccaagggacgccagagcaaaggggacataaacacc
aggaacaacggagagcgagcttcctgtgaaagtgatgttctccgtttcacctccaccacg
acctggaagaaccgaatcatcataacgtggcaccggtaccggccgccggactaccgggat
ctcatcagcttcacagtttactacaaggaggcaccatttaaaaacgttacggaatatgac
gggcaggatgcctgtggctccaacagctggaacatggtggatgtagacctgcctccgaac
aaggagggcgagcctggcattttactgcatgggctgaagccctggacccagtatgctgtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccatatccgtggggccaaaagt
gaaatcttgtacattcgcaccaatgcttcagtcccttccattcccctagatgtcctctca
gcatcaaactcttcctctcagctgattgtgaagtggaatcctccaactctgcccaatggt
aacttgagttactacattgtgaggtggcagcggcagccccaggatggttacctgtaccgg
cacaactactgctccaaagacaaaatacccatcagaaagtacgccgatggtaccatcgac
gtggaggaggtgacggaaaatcccaagacagaagtgtgtggtggtgataaagggccatgc
tgcgcttgccctaaaactgaagctgagaagcaggctgagaaggaggaggctgagtaccgt
aaagtctttgagaatttccttcacaattccatctttgtgcccaggcccgaaaggaggcgg
agagacgtcatgcaagtggccaacacgaccatgtccagccgaagcaggaacaccacggta
gctgacacctacaatatcacagacccggaggagttcgagacagagtaccctttctttgag
agcagagtggataacaaggagaggactgtcatctccaacctccggcctttcactctgtac
cgcatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaac
ttcgtctttgcgagaaccatgccagcagaaggagcagatgatatccctggtccggtgacc
tgggagccaagacccgaaaactccatctttttaaagtggccagaacccgagaaccccaac
ggattgatcctaatgtatgaaattaaatacgggtcgcaagtcgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtacggaggggccaaactcaaccgtctaaacccaggg
aactatacagcccggattcaggctacctccctctctgggaatgggtcatggacagatcct
gtgttcttctatgtccccgccaaaacgacgtatgagaacttcatgcatctgatcattgct
ctgccggttgccatcctgctgatcgttggggggctggttatcatgctgtatgtcttccat
agaaagagaaataacagcaggttgggcaatggagtgctgtatgcttctgtgaaccccgag
tatttcagcgcagctgatgtgtacgtgcctgatgaatgggaggtagctcgagagaagatc
accatgaaccgggagctcggacaagggtcctttgggatggtctatgaaggagtggccaag
ggtgtggtcaaggatgaacccgaaaccagagtggccatcaagacggtaaacgaggctgca
agtatgcgtgaaagaatcgagtttctcaacgaggcctcggtgatgaaggagttcaattgt
caccatgtggtccggttgctgggtgtggtatcccaaggccagcccaccctggtcatcatg
gaactaatgacacgcggtgatctcaaaagttatctccggtctctgaggccagaagtggag
cagaataatctagtcctcattcctccgagcttaagcaagatgatccagatggctggagag
attgcagatggcatggcctacctcaatgccaacaagttcgtccacagagaccttgctgct
aggaactgcatggtagccgaagatttcacagtcaaaattggagatttcggtatgacacga
gacatctacgagacggactactaccggaaaggcgggaaggggttgctgcctgtgcgctgg
atgtctcccgagtccctcaaggatggtgtcttcactactcattctgatgtctggtccttc
ggggtcgtcctctgggagatcgccacgctggctgagcagccctaccagggcttgtccaac
gagcaagttcttcgtttcgtcatggagggtggccttctggacaagccggacaactgccct
gatatgctgtttgaacttatgcgcatgtgctggcagtataaccccaagatgcggccctcc
ttcctggagatcatcggcagcatcaaggatgagatggagcccagcttccaggaggtctcc
ttctactacagcgaggagaacaagcctcccgagccagaggagctggagatggagcctgag
aacatggagagcgtcccactggacccttcggcctcctcagcctccctgcctctgcctgaa
agacactcaggacacaaggctgagaatggcccgggccctggcgtgctcgttctccgcgcc
agttttgatgagagacagccttacgctcacatgaacgggggacgcgccaacgagagggcc
ttgcctctgccccagtcctcgacctgctga

KEGG   Mus musculus (mouse): 18595
Entry
18595             CDS       T01002                                 

Gene name
Pdgfra, AI115593, CD140, CD140a, Pdgfr, Pdgfr-2
Definition
(RefSeq) platelet derived growth factor receptor, alpha polypeptide
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18595 (Pdgfra)
   04014 Ras signaling pathway
    18595 (Pdgfra)
   04015 Rap1 signaling pathway
    18595 (Pdgfra)
   04630 JAK-STAT signaling pathway
    18595 (Pdgfra)
   04020 Calcium signaling pathway
    18595 (Pdgfra)
   04072 Phospholipase D signaling pathway
    18595 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    18595 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18595 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18595 (Pdgfra)
   04540 Gap junction
    18595 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18595 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18595 (Pdgfra)
   05206 MicroRNAs in cancer
    18595 (Pdgfra)
   05230 Central carbon metabolism in cancer
    18595 (Pdgfra)
   05231 Choline metabolism in cancer
    18595 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    18595 (Pdgfra)
   05218 Melanoma
    18595 (Pdgfra)
   05215 Prostate cancer
    18595 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    18595 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18595 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18595 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18595 (Pdgfra)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18595 (Pdgfra)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   18595 (Pdgfra)
CD molecules [BR:mmu04090]
 Proteins
  18595 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Ig_6 C2-set_2 DUF3475 C1-set Kinase-like
Other DBs
NCBI-GeneID: 18595
NCBI-ProteinID: NP_001076785
MGI: 97530
Ensembl: ENSMUSG00000029231
Vega: OTTMUSG00000056081
UniProt: P26618
Position
5 C3.3; 5 39.55 cM
AA seq 1089 aa
MGTSHQVFLVLSCLLTGPGLISCQLLLPSILPNENEKIVQLNSSFSLRCVGESEVSWQHP
MSEEDDPNVEIRSEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVPASYDSRQGFNG
TFSVGPYICEATVKGRTFKTSEFNVYALKATSELNLEMDARQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIEPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELSTLVPASILDL
VDDHHGSGGGQTVRCTAEGTPLPEIDWMICKHIKKCNNDTSWTVLASNVSNIITELPRRG
RSTVEGRVSFAKVEETIAVRCLAKNNLSVVARELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKPKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccaccaggtctttctggtcctcagctgtctcctcacagggccgggcctc
atctcctgccagctcttattaccctctatcctcccaaacgagaatgagaagattgtgcag
ctgaattcgtccttttctctgagatgcgttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagacgaccccaacgtggaaatcagaagtgaggagaacaacagtggcctc
tttgtcacagtgctggaagtggttaacgcctccgcagcccacaccggatggtacacttgc
tactacaaccacactcagacggatgagagtgagatcgaaggcaggcacatttacatctat
gtaccagacccagacatggcctttgtgcctctcgggatgaccgattccttagtcatcgtg
gaagaggatgactctgccatcataccttgccgcaccacagatccggagactcaagtaacc
ttgcacaataacgggaggctggtgcctgcctcctatgacagcaggcagggcttcaacgga
accttcagcgtggggccttacatctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaatgtttatgccttgaaagcaacgtcagaactgaatctggagatggacgca
cgccagactgtgtataaggcaggagaaacgatcgtggtgacctgtgccgtctttaacaac
gaggtcgttgacctgcagtggacttaccctggagaagtgagaaacaaaggtatcaccatg
ctggaggagatcaaactcccatccatcaaactggtgtacactttgaccgtccccaaggcc
acggtgaaggacagtggagagtatgaatgtgctgcccgtcaggccactaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtcgagattgagcccacc
tttggccagctggaagctgtcaacttgcacgaagtcagagagttcgtggtggaggtgcag
gcctacccgacgcccaggatatcgtggctgaaggacaacttgactctgatagagaatctc
accgagatcaccactgatgtacagaagagtcaggaaacaaggtatcagagcaaattaaag
ctgatccgggctaaggaagaagacagtggccattacaccattatagttcaaaatgaggat
gacgtgaagagttacacgtttgagctgtcaaccctagttcctgcatccattttggatctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgtacagccgaaggcacc
cctcttccagaaatcgactggatgatctgcaagcatattaagaaatgtaataatgacact
tcgtggacagttttggccagcaatgtctcaaatattatcacagagctccctcgccgtggc
aggagtaccgtggagggacgagtgtccttcgccaaagtggaagagaccatcgcagttcga
tgcctggcaaagaacaacctcagcgttgtggcccgtgagctgaagctggtggctcccact
ctgcgatctgaactcacagtggcggccgcagtgttggtgctgttggtgattgtcattgtc
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttatcgagtcaatcagccccgatggacatgagtatatctatgtggaccccatgcagttg
ccttacgactccagatgggaattcccgagagatggcctcgtgcttggtcggattttggga
tccggtgcatttgggaaagtggtcgaaggtacagcttatggattaagccggtcccaacct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgaaaagcaggct
ctcatgtctgagctgaagataatgactcacctggggccacatttgaacattgtgaacttg
ctgggagcctgcaccaagtcaggtcccatttacatcatcacagaatactgcttctatggg
gatttggtcaactacttgcataagaacagagatagcttcatgagccaacacccagagaag
ccgaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataacggcgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaaatactctgacatccagagatcg
ctgtacgatcggccagcctcctacaagaagaaatccatgctagactcagaagtcaaaaac
ctcctttcggacgatgactccgagggtctgactttgctggatctattgagcttcacctat
caagttgctcgaggaatggaatttttggcttcgaaaaattgtgtccaccgggacctggct
gcccgcaacgtcctcctggcgcaaggaaaaattgtgaagatctgtgattttggcctggcc
agagacatcatgcacgattccaactacgtgtcaaaaggcagtactttcctgcctgtgaag
tggatggcacccgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtcc
tatggcattctgctctgggaaatcttttcccttggtggcacaccctatcctggcatgatg
gtcgattctactttctacaataagatcaagagtggataccggatggccaaacctgaccat
gccaccagtgaagtctatgagatcatggtgcagtgctggaacagtgagcccgagaagaga
ccctccttctaccacctcagcgagatagtggagaacctgttgccgggacaatacaagaag
agttatgaaaagattcacctggacttcctaaagagtgaccatccggccgtggcacgcatg
cgggtggactctgataatgcgtacatcggtgtcacttacaaaaatgaagaggataagctg
aaggactgggaaggtggcctggacgaacagagactgagcgctgacagtggctacatcatc
cccctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacac
agctcacagacttcggaagagagtgccatcgagacaggttccagtagttccaccttcatc
aagagagaggacgagaccatcgaggacatcgacatgatggatgacattggtatagattcc
tcggacctggtggaggacagcttcctgtaa

KEGG   Mus musculus (mouse): 18596
Entry
18596             CDS       T01002                                 

Gene name
Pdgfrb, AI528809, CD140b, PDGFR-1, Pdg, Pdgfr
Definition
(RefSeq) platelet derived growth factor receptor, beta polypeptide
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18596 (Pdgfrb)
   04014 Ras signaling pathway
    18596 (Pdgfrb)
   04015 Rap1 signaling pathway
    18596 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    18596 (Pdgfrb)
   04020 Calcium signaling pathway
    18596 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    18596 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    18596 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18596 (Pdgfrb)
   04540 Gap junction
    18596 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18596 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18596 (Pdgfrb)
   05206 MicroRNAs in cancer
    18596 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    18596 (Pdgfrb)
   05231 Choline metabolism in cancer
    18596 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    18596 (Pdgfrb)
   05218 Melanoma
    18596 (Pdgfrb)
   05215 Prostate cancer
    18596 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18596 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18596 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18596 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18596 (Pdgfrb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18596 (Pdgfrb)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   18596 (Pdgfrb)
CD molecules [BR:mmu04090]
 Proteins
  18596 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set TCAD9
Other DBs
NCBI-GeneID: 18596
NCBI-ProteinID: NP_032835
MGI: 97531
Ensembl: ENSMUSG00000024620
Vega: OTTMUSG00000014920
UniProt: P05622
Position
18 E1; 18 34.41 cM
AA seq 1098 aa
MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGSAPVM
WEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTG
TFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSG
AGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLE
LSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVT
FWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILAL
VVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALP
VGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPS
APERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDY
IIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQ
PQDSGCPGPLAEAEDSFL
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggggcttccaggagtgataccagctttagtcctcagaggccagttgttgctgtccgtg
ttatggctcctgggaccgcagacctcccggggcctagtcatcacgccccctgggccagag
tttgttctcaacatctccagcacctttgttctgacctgctcgggctcagctccggtgatg
tgggaacagatgtcccaggtgccctggcaagaagcggccatgaatcaggacggcaccttc
tccagtgtgctgacactgaccaatgtcactgggggagacactggggaatacttttgtgtc
tacaacaactcactagggccggagctcagtgagaggaagcgtatctatatctttgtgcca
gatcccaccatgggcttcctccctatggactccgaggacctgttcatttttgtcacggat
gtcactgagacgacaattccgtgccgagtgacagacccccagctggaggtgacgctacat
gagaagaaagtggatatccccctacacgtaccctacgaccaccagcgaggtttcactggt
acttttgaggacaagacttacatttgcaaaaccaccattggggacagggaagtggactcc
gatacttactacgtctacagcctccaggtgtcatccatcaacgtctctgtgaatgccgtg
cagactgtggtccgccagggcgagagcatcaccatccggtgcattgtgatgggcaatgat
gtggtgaacttccaatggacgtacccccgcatgaagagtgggcggctggtggagccagtg
acagactacctctttggagtgccctcccgcattggctccatcctgcatatccccacggct
gagctgagtgattcgggcacctatacttgcaacgtgtcagtgagtgtgaacgaccatggc
gatgagaaagccatcaacatctctgtgatcgagaatggctacgtgcggctgctggagaca
ctgggagatgtagaaattgctgagctgcaccggagtcggacgctgcgggtggtgttcgag
gcttatccgatgccttctgtcctgtggctcaaggacaaccgtaccttgggtgactccggc
gctggcgagttagttttgtctactcgcaacatgtctgagacccggtacgtgtcagaactg
atcctggtacgtgtgaaggtgtcagaagcgggctactatactatgcgagccttccacgag
gacgatgaggtccagctctccttcaagctgcaggtcaatgtccccgtccgtgtgctggag
ctgagtgagagtcaccctgccaatggggagcagacaatccgctgtcgtggccggggcatg
cctcagccaaatgtcacctggtctacctgcagagacctcaaaaggtgtccacgaaaactg
tcacccacacccttggggaatagttccaaggaggagagccagctagaaacgaatgtgact
ttctgggaggaagatcaggaatacgaggtggtgagcacactgcgcctgcgccacgtggat
cagccactgtccgtacgctgcatgctgcagaactccatgggtggagattcgcaggaggtc
accgtggtcccacattccttgcccttcaaagtggtggtgatctcagccatcctggcctta
gtggtccttaccgtcatctctctcatcatcctcatcatgctgtggcagaagaagccacgc
tatgagatccgatggaaggtcattgagtctgtgagctctgacggtcatgagtacatctac
gtggaccctgtgcagttgccttacgactccacctgggagctgccacgggaccagcttgtt
ctgggacgcactcttggctctggggctttcggacaggtggtggaggccacagctcacggt
ctgagccattcgcaggccaccatgaaagtggctgtcaagatgctgaaatcgacagccaga
agtagcgagaagcaagccttaatgtccgagctgaagattatgagtcatcttggaccccac
ctgaacgtggtcaacctgctgggggcctgcaccaaaggagggcccatctacatcatcacg
gaatactgccgatacggtgatctggtggactacctgcaccggaacaaacacaccttcttg
cagcgacactccaacaagcattgtccgcccagtgctgagctctacagcaacgccctgcca
gtggggttctccctacccagccacttgaacctgactggggagagtgacggtggctacatg
gatatgagcaaggatgaatctatagattacgtgcccatgttggacatgaaaggagacatc
aaatacgcagacattgagtcccccagctacatggccccttatgataactatgtcccatct
gcccctgaaaggacctatcgcgccaccttaatcaacgactcaccagtgctcagctacaca
gacctcgtgggcttcagctaccaagtggccaacggcatggacttcttagcctctaagaac
tgtgttcaccgagacttggcggccaggaatgtgctcatctgcgagggcaagctggtcaag
atctgtgacttcggcctggctcgagacatcatgagggactcaaactacatctccaaaggc
agcaccttcctgcctctgaagtggatggccccagagagcatcttcaacagcctctacacc
actttgagtgatgtctggtcttttgggatcctactctgggagatcttcacactgggtggc
accccttacccagagctgcccatgaacgaccagttctacaatgccatcaagaggggctac
cgcatggcccagcctgctcatgcctccgacgagatctatgagatcatgcagaaatgctgg
gaagaaaagtttgagactcgaccccccttctcccagctggtgctgctcctggagaggctt
ctgggtgaaggctataaaaagaagtaccagcaggtagatgaggagttcctgaggagtgac
catcctgccatcctgaggtcccaagcccgctttccggggatccacagcctccgatcccct
ctggacaccagctctgttctctacactgccgtgcagcccaatgagagtgacaatgactac
atcatccccttacctgaccccaagcctgacgttgctgatgaaggtctcccagaggggtcc
cccagccttgccagttccaccttgaatgaagtcaacacttcctccaccatctcctgcgac
agtcccctggagctccaagaagagccacagcaagcagagcctgaggcacaactggagcag
ccacaggattcaggctgcccaggacctctggctgaagcagaggacagcttcctgtag

KEGG   Mus musculus (mouse): 23920
Entry
23920             CDS       T01002                                 

Gene name
Insrr, Irr
Definition
(RefSeq) insulin receptor-related receptor
  KO
K05086  insulin receptor-related receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04810  Regulation of actin cytoskeleton
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    23920 (Insrr)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    23920 (Insrr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    23920 (Insrr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     23920 (Insrr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   23920 (Insrr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Other DBs
NCBI-GeneID: 23920
NCBI-ProteinID: NP_035962
MGI: 1346037
Ensembl: ENSMUSG00000005640
Vega: OTTMUSG00000035156
UniProt: Q9WTL4 Q3UQC8
Position
3 F1; 3 38.7 cM
AA seq 1300 aa
MAVPALWPWGVHLLMSLLSLGSGLDTLEVCPSLDIRSEVTELRRLENCSVVEGHLQILLM
FAATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLTVIRGTRLFLGYALIIFEM
PHLRDVGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGTNHIVGNKLGEECADVC
PGVLGAAGEPCSRTTFSGRTDYRCWTSSHCQKVCPCPRGMACTAGGDCCHSECLGGCSQP
EDPRACVACRHLYFQGVCLRACPPGTYQYESWRCVTAELCAHLREVPGLATTFGIYEGSC
LAQCPPGFTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQATQDLVGCTHVEGNLILNLRQ
GYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNLKLIRGDSMVDGNYTLYVLDNQ
NLQQLGSWVTAGLTIPVGKIYFAFNPRLCLEHIYQLEEVTGTRGRQSKAEINPRTNGDRA
ACQTRTLRFVFNLTEEDRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGT
QSWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRT
LPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNITYYLVLWQRLAEDGDLYINDYCHRG
LRLPTSSHDTRFDREDPALEAEPEQGCCPCQHSPPGQALPALEAQEVTFQKKFENFLHHA
ITIPKAPWKVTSINKNPQRDSERHRREAGLLRLGKNNSDFEIQEDKVPRERAILSGLRHF
TEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWKAAGKSSVTLHWLEPP
DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKVGGVHLALLPPGNYSAKVRATSLAGNGS
WTDGVTFYITDLEEEDTGGMRIFLTVTPVGFMLLVTLAALGFFYSRKRNSTLYTSVNPEY
FSASHMYVPDEWEVPREQIAIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELAS
ARERVEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAEN
NPGLPQPALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
VLKFVMDGGVLEELENCPIQLQELMRLCWQHSPRLRPTFVHILDRIQDELRPSFRLCSFY
YSPECQRGQASLLPTEAEPDSPPTLNGASDYSAPNGGPGH
NT seq 3903 nt   +upstreamnt  +downstreamnt
atggcagtgcctgctctgtggccctggggagtacacttgcttatgagcctgctgtccttg
ggatctggcctggacacactagaggtgtgccccagcctggatatccgctcggaggtgacc
gagctccgtcggctggagaactgcagtgtggtggagggtcacctgcagatccttcttatg
tttgctgccactggagaggatttccgaggcctcagctttcctcgccttacccaggtgact
gactacctgctgttgttccgagtctatggcctggagagccttcgagacctcttccccaac
ctcactgtgatccgaggcacccggctcttcctgggctacgcactcattatctttgagatg
ccccacctacgggacgtcgggctgccgtcgcttggggccgtgctgcgtggggccgtgcgt
gtggagaagaaccaggaactttgccatctctccaccattgactggggtctgctgcagcct
gcacctggtaccaaccacattgtaggaaacaagctgggcgaggagtgtgcagacgtgtgc
cccggtgtgctgggagctgctggtgagccctgttcgagaaccaccttcagcgggcgcact
gactacaggtgctggacgtccagccactgtcagaaagtgtgtccctgcccccgagggatg
gcctgcacagcaggcggtgattgctgccacagtgagtgtctggggggctgcagccagcct
gaagaccctcgagcctgtgtagcttgccgccacctctacttccaaggagtctgcctccga
gcctgccctccgggcacctaccaatatgagtcctggcgctgtgtcaccgcggagctctgc
gctcatctgcgtgaggttcctggacttgccaccaccttcggcatctacgagggcagctgc
ctagctcagtgccctccaggcttcacccgcaatggcagcagcattttctgccataagtgt
gagggcctgtgccccaaagagtgcaaggttgggacaaagaccatcgactctgtccaagcc
acacaggacctggtgggctgcacccacgtggagggaaacctcatcctcaaccttcgccaa
ggctacaatctggagccagagcttcaacgcaacctgggtctggtggagaccatcactggc
ttcctcaaaatcaagcactcttttgcactcgtgaccctgggctttttcaagaacctcaaa
ctaatccggggagattccatggtggatgggaattacactctctacgtattggacaaccag
aacctgcaacagttgggatcctgggtgaccgcggggctcaccattcccgtgggcaaaata
tacttcgccttcaacccacgcctctgcttggagcacatataccaactggaggaggtgacg
ggaaccagaggtcggcagagcaaggctgaaatcaacccccggaccaatggagatcgggct
gcctgtcagactcgcactctacgttttgtgttcaacctgacggaggaagaccgcatcctc
ctgcgctgggagcgctatgagccactggaggcccgtgacctgctcagcttcattgtctat
tacaaggagtccccatttcagaatgccacagaacacgtgggtccagatgcctgtggaacc
cagagctggaacctgttggatgtggaactacccctcagccgcacccaggaaccaggggta
accctggccccccttaagccctggacacagtatgctgtgtttgtgcgggccatcacactg
accaccgctgaggacagtccccatcagggagcccagagccccattgtctacctgcgaaca
ttgcctgctgcacccacggtgccccaagatgtcatctccacctccaactcctcttcccac
ctcctggtgcgctggaagccaccggtccagcgcaatggaaacatcacctactacctggtg
ctgtggcagcgcctggcggaggacggtgacctctacatcaatgactactgccaccgcggt
ctgcggctgcccaccagcagccacgacacacgcttcgaccgtgaagacccggcgctggag
gctgagccggaacaaggctgctgtccttgccaacactcacctcctgggcaggccctgcct
gcactggaggctcaagaggtcaccttccagaaaaaatttgaaaacttcctacaccatgcc
atcaccatccccaaggctccatggaaagtgacatccatcaacaagaacccccaaagggat
tcggagaggcaccgcagggaagctggacttctcagactagggaaaaacaactcggatttt
gagattcaagaggacaaggttccccgggagcgagcgatattgagcggcttacggcacttc
acagagtacaggattgacatccatgcctgcaaccacgctgcgcacactgtgggctgcagc
gccgccaccttcgtctttgcacgcaccatgccacatagagaggccgatggcatcccgggg
aaagtggcctggaaggcagctggcaagagcagtgtcaccttgcattggcttgaaccacct
gaccccaatgggctcattctcaagtatgaaatcaagtaccgacgtctgggagaggaggcc
acagtgctttgtgtgtcccgtcttcgatatgccaaagtcggtggagtccacctggctctg
ctgccccctggaaactactctgctaaagttcgggccacctcgttggctggcaatggttcc
tggactgacggtgttaccttctacatcaccgatctagaggaagaggataccggggggatg
cgcatcttcctcactgtcacccctgtggggttcatgctgctcgtgacacttgctgccctc
ggtttcttctacagcagaaagagaaacagcacgctgtacacatccgtgaaccccgagtat
ttcagtgcatcccacatgtatgtccccgacgagtgggaggtgcctcgggagcagatagcc
atcatccgggagctgggccaaggctcttttgggatggtctatgagggactggcccgagga
cttgaggctggagaggagtccacgcctgtagccctgaagacagttaatgagctggccagc
gctcgggaacgcgttgaattcctcaaggaagcatctgtcatgaaggcattcaagtgtcac
catgtggttcgtctcctgggtgtggtgtctcagggccagccaactctggtcatcatggag
ttaatgacccgtggggacctcaagagccatctccgatctctgagacctgaggcagagaac
aaccccggcctcccgcagcctgcactcagtgacatgattcagatggcaggggaaattgca
gatggcatggcctaccttgctgccaagaagtttgtgcaccgggacctggcggcccgcaac
tgcatggtgtcccaggatttcacagtcaaaattggtgactttggaatgactcgggatgtg
tatgagacagactattaccgcaagggtggaaaagggttactgccagtgcgctggatggcc
cccgagtccctcaaagatggaatcttcaccactcactcagatgtctggtccttcggtgtg
gtgctctgggagattgtgaccctggccgaacaaccataccagggtctatcaaatgagcag
gtgctgaaatttgtcatggatggtggagttctagaggagctggagaactgtccgattcag
ctacaagagctgatgagactctgctggcagcatagtccacgcctgcgcccgactttcgtc
cacatcctggatcgcatacaggatgagcttcggccctctttccggctctgctccttctac
tacagcccagagtgccagcggggtcaggcctccttgctgcctactgaggcagaacctgat
tccccaccaaccttaaatggagcttcagactatagtgccccaaatgggggcccaggacac
tga

DBGET integrated database retrieval system