KEGG   Mus musculus (mouse): 13654Help
Entry
13654             CDS       T01002                                 

Gene name
Egr2, Egr-2, Krox-20, Krox20, NGF1-B, Zfp-25, Zfp-6
Definition
(RefSeq) early growth response 2
  KO
K12496  early growth response protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    13654 (Egr2)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    13654 (Egr2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    13654 (Egr2)
   05161 Hepatitis B
    13654 (Egr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13654 (Egr2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    13654 (Egr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3446 zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-BED zf-C2HC_2 Zf_RING zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 13654
NCBI-ProteinID: NP_034248
MGI: 95296
Ensembl: ENSMUSG00000037868
Vega: OTTMUSG00000033571
UniProt: P08152 Q3U207
Position
10 B5.1; 10 34.96 cM
AA seq 470 aa AA seqDB search
MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAASSVTIFPNGELGGPFDQMNGVAGDGMI
NIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGI
LQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCTGD
LYQDPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHG
AAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSA
AVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRI
HTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQ
KERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRTP
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgccaaggccgtagacaaaatcccagtaactctcagtggttttatgcaccag
ctgcctgacagcctctacccggtggaagacctcgccgcctcgtcggtgaccatcttcccc
aatggtgaactgggaggcccctttgaccagatgaacggagtggcgggagatggcatgatc
aacattgacatgactggagagaagagacccctggatctcccgtatccgagtagcttcgct
cccatctctgcacctagaaaccagaccttcacttacatgggcaaattctccattgaccca
cagtaccctggtgccagctgctatccagaaggtatcatcaatattgtgagtgcgggcatc
ttgcaaggggtcacccctccagcttcaaccacagcctcctccagcgtcacctccgcctcc
cccaacccactggccacgggacccctgggtgtgtgtaccatgtcccagactcagcctgaa
ctggaccacctctactctccgccaccacctcctcctccttattcgggctgtacaggagat
ctctaccaggatccttcagcattcttatcgccgccatccaccacttccacctcctctctg
gcctaccagccacctccttcctacccatcccccaagccagctatggacccaggtctcatt
cctatgatcccagactatcctggattttttccatctccgtgccagagagatccacacggt
gctgctggcccagatcgaaagccgtttccctgtcctctggactccctgcgagtgccccct
ccactcacgccactctctaccatccgtaattttactctggggggtcccggtgctggagtc
acgggaccaggagcaagtggaggtggtgagggacctcggctgcctggcagtgggtctgca
gcagtgactgccaccccttataatccgcaccacctgccattgcggcccatcctgcgacct
cgaaagtaccctaacaggcccagcaaaacgccagtgcacgaaaggccctatccctgccca
gcagaaggttgtgataggaggttctcacgctctgatgagctgaccaggcacatccgaatc
cacacgggccacaagcccttccagtgtcggatctgcatgcgaaacttcagccgaagtgac
caccttactactcacatccgaacccacaccggggagaagccctttgcctgtgactattgt
ggccgcaagtttgccaggagtgacgaaaggaagcgccacaccaagatccaccttcggcag
aaggaacggaagagcagtgctccctctgcacctccatctgcccagtcttcagcctctggt
cctgggggctcgcaggccgggggcagcctgtgcggtaacagcgccattggaggaccactg
gcctcctgcacctctcgaaccaggacaccgtga

DBGET integrated database retrieval system