KEGG   Mus musculus (mouse): 13654
Entry
13654             CDS       T01002                                 

Gene name
Egr2, Egr-, Egr-2, Krox, Krox-, Krox-20, Krox20, NGF1-, NGF1-B, Zfp-2, Zfp-25, Zfp-6
Definition
(RefSeq) early growth response 2
  KO
K12496  early growth response protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    13654 (Egr2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    13654 (Egr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    13654 (Egr2)
   05161 Hepatitis B
    13654 (Egr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13654 (Egr2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    13654 (Egr2)
SSDB
Motif
Pfam: DUF3446 zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-BED zf-C2HC_2 zf-H2C2_5 Zf_RING zf-C2H2_8
Other DBs
NCBI-GeneID: 13654
NCBI-ProteinID: NP_034248
MGI: 95296
Ensembl: ENSMUSG00000037868
Vega: OTTMUSG00000033571
UniProt: P08152 Q3U207
Position
10 B5.1; 10 34.96 cM
AA seq 470 aa
MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAASSVTIFPNGELGGPFDQMNGVAGDGMI
NIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGI
LQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCTGD
LYQDPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHG
AAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSA
AVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRI
HTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQ
KERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRTP
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgatgaccgccaaggccgtagacaaaatcccagtaactctcagtggttttatgcaccag
ctgcctgacagcctctacccggtggaagacctcgccgcctcgtcggtgaccatcttcccc
aatggtgaactgggaggcccctttgaccagatgaacggagtggcgggagatggcatgatc
aacattgacatgactggagagaagagacccctggatctcccgtatccgagtagcttcgct
cccatctctgcacctagaaaccagaccttcacttacatgggcaaattctccattgaccca
cagtaccctggtgccagctgctatccagaaggtatcatcaatattgtgagtgcgggcatc
ttgcaaggggtcacccctccagcttcaaccacagcctcctccagcgtcacctccgcctcc
cccaacccactggccacgggacccctgggtgtgtgtaccatgtcccagactcagcctgaa
ctggaccacctctactctccgccaccacctcctcctccttattcgggctgtacaggagat
ctctaccaggatccttcagcattcttatcgccgccatccaccacttccacctcctctctg
gcctaccagccacctccttcctacccatcccccaagccagctatggacccaggtctcatt
cctatgatcccagactatcctggattttttccatctccgtgccagagagatccacacggt
gctgctggcccagatcgaaagccgtttccctgtcctctggactccctgcgagtgccccct
ccactcacgccactctctaccatccgtaattttactctggggggtcccggtgctggagtc
acgggaccaggagcaagtggaggtggtgagggacctcggctgcctggcagtgggtctgca
gcagtgactgccaccccttataatccgcaccacctgccattgcggcccatcctgcgacct
cgaaagtaccctaacaggcccagcaaaacgccagtgcacgaaaggccctatccctgccca
gcagaaggttgtgataggaggttctcacgctctgatgagctgaccaggcacatccgaatc
cacacgggccacaagcccttccagtgtcggatctgcatgcgaaacttcagccgaagtgac
caccttactactcacatccgaacccacaccggggagaagccctttgcctgtgactattgt
ggccgcaagtttgccaggagtgacgaaaggaagcgccacaccaagatccaccttcggcag
aaggaacggaagagcagtgctccctctgcacctccatctgcccagtcttcagcctctggt
cctgggggctcgcaggccgggggcagcctgtgcggtaacagcgccattggaggaccactg
gcctcctgcacctctcgaaccaggacaccgtga

KEGG   Mus musculus (mouse): 13655
Entry
13655             CDS       T01002                                 

Gene name
Egr3, P, Pilot
Definition
(RefSeq) early growth response 3
  KO
K12497  early growth response protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05161  Hepatitis B
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    13655 (Egr3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    13655 (Egr3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    13655 (Egr3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13655 (Egr3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    13655 (Egr3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 DUF3446 zf-C2H2_4 zf-C2HC_2 zf-BED zf-H2C2_5 zf-C2H2_6 zf-C2H2_8
Other DBs
NCBI-GeneID: 13655
NCBI-ProteinID: NP_061251
MGI: 1306780
Ensembl: ENSMUSG00000033730
UniProt: P43300
Position
14; 14 D2
AA seq 387 aa
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYNQMATENVMDIGLT
NEKPNPELSYSSSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKSEKGGAPSASSAPTVSLAPVVTTCA
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaatcaattg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctccggcagcagc
gactcggtagcccattacaatcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaatccggaactctcttattcgagctctttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgctttcgactctccttccaactggtgccaggac
aacatcattagcctcatgagtgccggcatcttgggggtgcccccggcctcaggggcgctc
agtacgcagacgtccacggctagcatggtgcagcctcctcagggagacgtggaggccatg
tatccggcgctgcctccttattccaactgcggcgatctctactcggagcccgtgtctttc
cacgacccccagggaaaccctgggctcgcctattccccccaggattaccaatcggccaag
ccggccttggacagcaatcttttccccatgattcctgactacaacctgtaccaccatccc
aacgacatgggctccattccggaacataagcccttccagggcatggaccccatccgggtc
aacccaccccctattaccccactggagaccatcaaggccttcaaagacaagcagatccac
ccgggattcggcagcctgccccaaccgccgctcactctcaagcccatccggccccgcaag
taccccaatcggcctagcaagaccccgctccacgagcggccccacgcgtgtcccgcggaa
ggctgtgaccgccgtttcagccgctcagacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgtcggatctgcatgcgcagcttcagccgcagcgaccacctc
accactcacatccgcacgcacaccggggagaagccctttgcctgtgagttctgtgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaagtcggagaaagggggtgcgccctctgcatcctcggcgcccaccgtgtccctggcc
cctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system