KEGG   Mus musculus (mouse): 13656Help
Entry
13656             CDS       T01002                                 

Gene name
Egr4, NGF1-C, NGFI-C, NGFIC, pAT133
Definition
(RefSeq) early growth response 4
  KO
K12498  early growth response protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13656 (Egr4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    13656 (Egr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 13656
NCBI-ProteinID: NP_065621
MGI: 99252
Ensembl: ENSMUSG00000071341
Vega: OTTMUSG00000055994
UniProt: Q9WUF2 Q3URA9
Position
6 C3; 6 37.48 cM
AA seq 478 aa AA seqDB search
MLHLSDFSGSDALLSKPTEGCAHASPELPRLPARDAPSAAAYPGGDFLSWALSSCGAGGD
LTDSCFLEGPAPTPPSGLSYSGSFFIQAVPEHPHDPEALFNLMSGILGLAPFPGPEAAAS
RSPLDVPFPAGPDALLPDLYSPDLSSAAFPEAFWEAAPSAGAPSQCLFEPQLSPPDVKPG
LRAPPASPALDAAASAFKGPYAPWELLSAGVPGNCGSQGSFQTTPEARFSAVGTKVEDLL
SISCPAELPGPAARLYQAGAYDTFSLAPGDLGEGTEGLPALLTPPGGEGGSGGEGGEFLA
APPAQLSPLGLRGAATADFSKPLVADLPGGSGVAAPSSPAASFPAAKARRKGRRGGKCSA
RCFCPRPHVKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTH
VRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFAAL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctccacctgagcgacttctccggctccgacgcgcttctctccaagcccaccgaaggc
tgcgcccacgccagccccgagctgccccggctgcctgctagggacgctccctcggccgcc
gcgtatcctggaggcgacttcttgagctgggctttgagcagctgcggcgccgggggggac
ttaacagactcctgcttcctggagggccctgcacccacgcccccttcgggcctcagctac
agcggcagcttcttcatccaggcggttcccgaacacccgcacgacccggaggccctcttc
aacctcatgtctggcatcttgggcctggcacccttccccggtcccgaggcggcagcgtct
cggtcccccctggatgtccctttccccgcgggccccgatgccttgctgccggacctctac
tccccagatctgagttcggccgcctttccggaggcgttttgggaggcagcgccttcggcg
ggcgctccctcgcagtgcctgttcgagccccagctctccccgcccgacgtcaagccaggg
ctgcgggcgcctcccgcttcgccagcgctggacgctgctgcttcagccttcaaagggccc
tatgccccctgggagctgctgtcggccggggtcccggggaactgtgggtcgcaggggagc
ttccagaccaccccggaggcccgcttctctgcagtagggaccaaggtcgaggacctgctg
tccatcagctgccccgccgagctgcccggcccggccgccagactctaccaggcaggggcc
tacgacaccttctcgttggccccaggtgacttaggggaggggaccgagggcctcccggcg
ctgctgacccctcccggcggggagggagggagcggcggcgaaggcggagagttcctggcc
gcccctccggcgcagctgtcccctctaggcctgcgcggtgccgccacggcggacttctcc
aaacccctggtggccgatctcccggggggcagcggcgtggccgcgccctcatcccccgcc
gcatccttccccgcggccaaagcccgacgcaagggacgccggggcggcaagtgcagcgcg
cgctgcttctgcccgcggccgcacgtcaaggccttcgcctgcccggtggagagctgcgtg
cggagcttcgcgcgctccgacgagctcaaccgccacctgcgcatccacacgggccacaag
cccttccagtgccgcatctgcctgcgcaacttcagccgcagcgaccacctcaccacgcac
gtgcgcacccacacgggcgagaagcccttcgcctgcgacgtgtgtggccgccgcttcgcg
cgcagtgacgagaagaaacggcacagcaaggtgcacctaaagcagaaggcgcgcgcggag
gagcgcctcaagggcctgggcttctactcgctgggcctctccttcgccgcgctgtaa

DBGET integrated database retrieval system