KEGG   Mus musculus (mouse): 13664
Entry
13664             CDS       T01002                                 

Symbol
Eif1a, C76390, Ef1, Ef1a, Eftu, Eif4, Eif4c, eIF-, eIF-1A, eIF-4C
Name
(RefSeq) eukaryotic translation initiation factor 1A
  KO
K03236  translation initiation factor 1A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    13664 (Eif1a)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-1
    13664 (Eif1a)
SSDB
Motif
Pfam: eIF-1a
Other DBs
NCBI-GeneID: 13664
NCBI-ProteinID: NP_034250
MGI: 95298
Ensembl: ENSMUSG00000057561
UniProt: Q60872 Q4FJR7
Position
18; 18 C
AA seq 144 aa
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVRRLCH
IRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
FGPGDDDEIQFDDIGDDDEDIDDI
NT seq 435 nt   +upstreamnt  +downstreamnt
atgccaaagaataaaggcaaaggaggcaaaaacaggcgcagaggtaaaaatgaaaatgaa
tctgagaaaagagagttggtgtttaaagaggatgggcaggagtatgctcaggtgatcaaa
atgctgggaaatggacggttggaagcaatgtgctttgacggtgtgaggaggctgtgccat
ataagagggaagctgagaaaaaaggtttggataaatacctcggacattatattgattggt
ctacgagactatcaagataacaaagctgatgtaatcttaaagtataatgcagatgaagca
agaagtctgaaggcctatggagaacttccagaacatgccaaaatcaatgaaacggacaca
tttggtcctggggatgatgatgaaatccaatttgatgatattggagatgatgatgaagac
attgatgacatctag

DBGET integrated database retrieval system