KEGG   Mus musculus (mouse): 13665Help
Entry
13665             CDS       T01002                                 

Gene name
Eif2s1, 0910001O23Rik, 2410026C18Rik, 35kDa, Eif2a, eIF2alpha
Definition
(RefSeq) eukaryotic translation initiation factor 2, subunit 1 alpha
  KO
K03237  translation initiation factor 2 subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    13665 (Eif2s1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13665 (Eif2s1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    13665 (Eif2s1)
  09143 Cell growth and death
   04210 Apoptosis
    13665 (Eif2s1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    13665 (Eif2s1)
  09172 Infectious diseases: Viral
   05162 Measles
    13665 (Eif2s1)
   05164 Influenza A
    13665 (Eif2s1)
   05160 Hepatitis C
    13665 (Eif2s1)
   05168 Herpes simplex virus 1 infection
    13665 (Eif2s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    13665 (Eif2s1)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-2
    13665 (Eif2s1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1 SoDot-IcmSS DUF4453
Motif
Other DBs
NCBI-GeneID: 13665
NCBI-ProteinID: NP_080390
MGI: 95299
Ensembl: ENSMUSG00000021116
Vega: OTTMUSG00000031427
UniProt: Q6ZWX6
Position
12; 12 C3
AA seq 315 aa AA seqDB search
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccggggctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtaagatccattgctgaaatgggggcctatgtcagcttgttggaatataat
aacattgaaggcatgattcttcttagtgaattatccagacgacgtatccgttctataaac
aaactgatccgaattggcagaaatgaatgtgttgttgtcattagagtggataaagaaaaa
ggatatatagatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaggac
aaattcacaaaatccaaaactgtttatagcattcttcgccatgttgctgaggtattagaa
tataccaaggatgagcagctggagagcctgttccagaggactgcctgggtcttcgatgac
aagtacaagagacctggatacggtgcctacgatgcttttaagcatgcagtctcagaccca
tctatcttggatagtttagatttgaatgaagatgaaagagaagtactcattaataatatc
aataggcgtttgaccccacaagcggtcaaaattcgagcagatattgaagtagcttgctat
ggttatgaaggcattgatgctgtaaaagaagccctgagggcaggtttgaattgttctaca
gaaaccatgcccatcaagattaatctaatagctccacccaggtatgtgatgacaacaacg
accctggagaggacagaaggcctgtctgtcctcaatcaggctatggcagttatcaaagag
aagatcgaggagaagaggggcgtcttcaatgttcagatggagcccaaagtggtcacagat
acagatgagactgaacttgcaaggcagctggaacggctggagagagaaaatgcagaagtg
gatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system