KEGG   Mus musculus (mouse): 13666
Entry
13666             CDS       T01002                                 

Gene name
Eif2ak3, PE, Pek, Perk
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05160  Hepatitis C
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13666 (Eif2ak3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    13666 (Eif2ak3)
   04137 Mitophagy - animal
    13666 (Eif2ak3)
  09143 Cell growth and death
   04210 Apoptosis
    13666 (Eif2ak3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    13666 (Eif2ak3)
   05162 Measles
    13666 (Eif2ak3)
   05168 Herpes simplex virus 1 infection
    13666 (Eif2ak3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13666 (Eif2ak3)
   05012 Parkinson disease
    13666 (Eif2ak3)
   05014 Amyotrophic lateral sclerosis
    13666 (Eif2ak3)
   05020 Prion disease
    13666 (Eif2ak3)
   05022 Pathways of neurodegeneration - multiple diseases
    13666 (Eif2ak3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    13666 (Eif2ak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13666 (Eif2ak3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13666 (Eif2ak3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   13666 (Eif2ak3)
SSDB
Motif
Pfam: PQQ PQQ_3
Other DBs
NCBI-GeneID: 13666
NCBI-ProteinID: NP_001300847
MGI: 1341830
Ensembl: ENSMUSG00000031668
Vega: OTTMUSG00000031093
UniProt: Q9Z2B5 A0A0R4J1Y1
Structure
PDB: 
4YZY

Position
6; 6 C1
AA seq 152 aa
MERATRPGPRALLLLLFLLLGCAAGISAVAPARSLLAPASETVFGLGAAAAPTSAARVPA
VATAEVTVEDAEALPAAAGEPESRATEPDDDVELRPRGRSLVIISTLDGRIAALDAENDG
KKQWDLDVGSGSLVSSSLSKPEGTHKTSSKEC
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagcgcgccacccggcccgggccgcgcgcgctgctgctgcttctgttcctgctgctg
ggctgcgcggcggggatctcggcggtcgcgcccgcccgcagtttgcttgctcccgcgtcg
gagacagtgtttggcttaggggcagcggccgccccgacttcggccgcgcgggtgcctgcg
gtggcaacggccgaagtgaccgtggaggacgccgaggcattgccggctgccgctggcgaa
ccggagtcacgcgcgacggagcccgatgacgacgtggaactgcggcctcgcggcaggtcc
ttggtaatcatcagcactttagatggacgaatcgctgcactggatgccgagaatgatggg
aaaaagcagtgggatttggacgtggggtctggttccttggtttcatctagcctcagcaag
ccagagggcacccacaaaacttcctcaaaagaatgttga

DBGET integrated database retrieval system