KEGG   Mus musculus (mouse): 13666
Entry
13666             CDS       T01002                                 

Gene name
Eif2ak3, PE, Pek, Perk
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05160  Hepatitis C
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13666 (Eif2ak3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    13666 (Eif2ak3)
   04137 Mitophagy - animal
    13666 (Eif2ak3)
  09143 Cell growth and death
   04210 Apoptosis
    13666 (Eif2ak3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13666 (Eif2ak3)
   05012 Parkinson disease
    13666 (Eif2ak3)
   05014 Amyotrophic lateral sclerosis
    13666 (Eif2ak3)
   05020 Prion disease
    13666 (Eif2ak3)
   05022 Pathways of neurodegeneration - multiple diseases
    13666 (Eif2ak3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    13666 (Eif2ak3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    13666 (Eif2ak3)
   05162 Measles
    13666 (Eif2ak3)
   05168 Herpes simplex virus 1 infection
    13666 (Eif2ak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13666 (Eif2ak3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13666 (Eif2ak3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   13666 (Eif2ak3)
SSDB
Motif
Pfam: PQQ PQQ_3
Other DBs
NCBI-GeneID: 13666
NCBI-ProteinID: NP_001300847
MGI: 1341830
Ensembl: ENSMUSG00000031668
Vega: OTTMUSG00000031093
UniProt: Q9Z2B5 A0A0R4J1Y1
Structure
PDB: 
4YZY

Position
6; 6 C1
AA seq 152 aa
MERATRPGPRALLLLLFLLLGCAAGISAVAPARSLLAPASETVFGLGAAAAPTSAARVPA
VATAEVTVEDAEALPAAAGEPESRATEPDDDVELRPRGRSLVIISTLDGRIAALDAENDG
KKQWDLDVGSGSLVSSSLSKPEGTHKTSSKEC
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagcgcgccacccggcccgggccgcgcgcgctgctgctgcttctgttcctgctgctg
ggctgcgcggcggggatctcggcggtcgcgcccgcccgcagtttgcttgctcccgcgtcg
gagacagtgtttggcttaggggcagcggccgccccgacttcggccgcgcgggtgcctgcg
gtggcaacggccgaagtgaccgtggaggacgccgaggcattgccggctgccgctggcgaa
ccggagtcacgcgcgacggagcccgatgacgacgtggaactgcggcctcgcggcaggtcc
ttggtaatcatcagcactttagatggacgaatcgctgcactggatgccgagaatgatggg
aaaaagcagtgggatttggacgtggggtctggttccttggtttcatctagcctcagcaag
ccagagggcacccacaaaacttcctcaaaagaatgttga

KEGG   Mus musculus (mouse): 15467
Entry
15467             CDS       T01002                                 

Gene name
Eif2ak1, H, HCR, Hri
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05160  Hepatitis C
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15467 (Eif2ak1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    15467 (Eif2ak1)
   05162 Measles
    15467 (Eif2ak1)
   05168 Herpes simplex virus 1 infection
    15467 (Eif2ak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    15467 (Eif2ak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     15467 (Eif2ak1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   15467 (Eif2ak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH PKcGMP_CC
Other DBs
NCBI-GeneID: 15467
NCBI-ProteinID: NP_038585
MGI: 1353448
Ensembl: ENSMUSG00000029613
Vega: OTTMUSG00000025503
UniProt: Q9Z2R9
Position
5; 5 G2
AA seq 619 aa
MLGGSSVDGERDTDDDAAGAVAAPPAIDFPAEVSDPKYDESDVPAELQVLKEPLQQPTFP
FLVANQLLLVSLLEHLSHVHEPNPLHSKQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCQDNSYMQKIRSREIAFEAQTSRYLNEFEELAILGKGGYGR
VYKVRNKLDGQHYAIKKILIKSATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVV
QPQDRVPIQLPSLEVLSEQEGDRDQGGVKDNESSSSIVFAELTPEKEKPFGESEVKNENN
NLVSYTANLVVRNSSESESSIELQEDGLTDLSVRPVVRHQLPLGHSSELEGNFTSTDESS
EGNLNLLGQTEVRYHLMLHIQMQLCELSLWDWITERNKRSREYVDEAACPYVMASVATKI
FQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACADIIQNADWTNRNGKG
TRTHTSRVGTCLYASPEQLEGSQYDAKSDMYSLGVILLELFQPFGTEMERATVLTGVRTG
RIPESLSKRCPVQAKYIQLLTGRNVSQRPSALQLLQSELFQTTGNVNLTLQMKIIEQEKE
IEELKKQLSLLSQDRGLKR
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgctggggggcagctccgtggacggcgagcgcgacacggacgacgacgcggcgggggcg
gtggccgcgcctcctgccatcgacttccccgcagaggtgtcggaccccaagtatgatgag
tccgatgtccccgcagagctccaagtgttaaaagagcccctacagcagcccacgttccct
ttcctggtggcaaaccagctgctgctcgtctccttactggaacacttgagccatgtgcac
gagccaaacccgctccactccaaacaggtgtttaaattactgtgccagacttttatcaag
atggggctgctctcttcctttacctgcagtgatgagtttagctctctgagactccaccac
aacagagccatcactcatttaatgaggtctgccaaagagagagtccgtcaggatccttgt
caagataattcttacatgcagaaaatcagatccagagagatagccttcgaagcacaaacg
tcacgctacttaaatgaatttgaagagcttgccatcttagggaaaggaggatatggaaga
gtttacaaggtccggaacaaattagatggtcagcattatgcaattaagaaaatcctgatt
aagagcgcaactaaaacagattgtatgaaggtgctacgggaagtgaaggttctggcaggt
ctccagcatcccaatattgttggctaccacactgcgtggatagaacatgttcatgtggtt
cagccacaagacagagttccgattcaactgccctctctcgaagtgctgtcggagcaggaa
ggggacagagaccaaggtggtgttaaagataatgaaagcagttcgtccattgtctttgct
gaactcaccccagaaaaagaaaaaccttttggggagtctgaggttaaaaatgagaataac
aacctggtgagctacacggccaacttagtggtcaggaacagcagtgaaagtgaatcgtcc
attgagctccaagaagacggcttgactgatttgtccgtcagaccagttgtcaggcatcag
ctgccgctggggcatagctcggaattggaagggaattttacatccacggatgagtcttct
gaaggcaacttgaacctgctggggcagacggaggttcggtaccacctgatgttgcacatc
cagatgcagctgtgtgagctctccctgtgggactggataactgagaggaacaagcggagc
cgggagtatgtggacgaagctgcttgtccctatgttatggccagtgttgcaacaaaaatt
tttcaagaattggtggaaggtgtcttttacatacataacatgggcattgtccacagagat
ctgaagcctagaaatatttttcttcatggccctgatcagcaagtaaaaataggagacttt
ggtctggcctgtgcagacatcatccagaatgcagactggaccaacagaaatgggaaagga
acacggacacacacatccagagtggggacttgtctctacgcatcaccggaacagctggag
ggatcccagtacgatgccaagtcagatatgtatagcttgggtgtgatcctgctcgagctc
tttcagccattcgggacagaaatggagagggcaacagtcttaacaggcgtaaggactggt
cggatacccgaatccctcagtaaaaggtgtccggtgcaagccaagtatatccagctccta
accgggaggaatgtgtcacagagaccatctgcccttcagctgctgcagagtgagcttttt
caaacaactggaaatgttaatctcacattgcagatgaagataatagaacaagagaaggaa
attgaagaactaaagaagcaactaagcctcctttctcaggacagagggctgaagagatga

KEGG   Mus musculus (mouse): 19106
Entry
19106             CDS       T01002                                 

Gene name
Eif2ak2, 2310047A08Rik, 4732414G15Rik, AI467567, AI747578, P, Pkr, Prkr, Ti, Tik
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04217  Necroptosis
mmu05010  Alzheimer disease
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    19106 (Eif2ak2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    19106 (Eif2ak2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    19106 (Eif2ak2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19106 (Eif2ak2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    19106 (Eif2ak2)
   05171 Coronavirus disease - COVID-19
    19106 (Eif2ak2)
   05164 Influenza A
    19106 (Eif2ak2)
   05162 Measles
    19106 (Eif2ak2)
   05168 Herpes simplex virus 1 infection
    19106 (Eif2ak2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19106 (Eif2ak2)
   05169 Epstein-Barr virus infection
    19106 (Eif2ak2)
   05165 Human papillomavirus infection
    19106 (Eif2ak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19106 (Eif2ak2)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19106 (Eif2ak2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19106 (Eif2ak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     19106 (Eif2ak2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   19106 (Eif2ak2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     19106 (Eif2ak2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     19106 (Eif2ak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm Pkinase_fungal Kdo Kinase-like APH DND1_DSRM
Other DBs
NCBI-GeneID: 19106
NCBI-ProteinID: NP_035293
MGI: 1353449
Ensembl: ENSMUSG00000024079
Vega: OTTMUSG00000036019
UniProt: Q03963
Structure
PDB: 
1X48 1X49

Position
17 E3; 17 49.56 cM
AA seq 515 aa
MASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQ
EARNAAAKLAVDILDNENKVDCHTSASEQGLFVGNYIGLVNSFAQKKKLSVNYEQCEPNS
ELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSSSVVTSTFS
GFSSSSSMTSNGVSQSAPGSFSSENVFTNGLGENKRKSGVKVSPDDVQRNKYTLDARFNS
DFEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKYNTEKAEHEVQALAELNHVNIVQYHS
CWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDLYEQI
VTGVEYIHSKGLIHRDLKPGNIFLVDERHIKIGDFGLATALENDGKSRTRRTGTLQYMSP
EQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDIFDNKEKSLLK
KLLSEKPKDRPETSEILKTLAEWRNISEKKKRNTC
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggccagtgataccccaggtttctacatggacaaacttaataaataccgccagatgcac
ggagtagccattacgtataaagaacttagtacttcgggacctccacatgacagaaggttt
acatttcaagttttaatagatgagaaggaatttccagaagccaaaggtagatcaaagcag
gaggcaagaaacgctgcagccaaattagctgttgatatacttgataacgaaaacaaggtg
gattgtcacacgagtgcatctgagcaaggcttgttcgttggtaactacataggccttgtc
aatagctttgcccagaagaaaaagctgtctgtaaattatgaacagtgtgagcccaactct
gagttgcctcaaagatttatttgtaaatgcaaaattgggcagacaatgtatggtactggt
tcaggtgtcaccaaacaggaggcaaagcagttggctgcgaaagaagcctatcagaagctg
ttaaagagcccgccgaaaactgccggaacatcctctagcgttgtcacatctacattcagt
ggcttttccagcagctcgtctatgacaagtaatggtgtttcccagtcagcacctggaagt
ttttcctcagagaacgtgtttacgaacggtctcggagaaaataaaaggaaatcaggagta
aaagtatcccctgatgatgtgcaaagaaataaatataccttggacgccaggtttaacagc
gattttgaagacatagaagaaattggcttaggtggatttggtcaagttttcaaagcgaaa
cacagaattgatggaaagagatacgctattaagcgcgttaaatataacacggagaaggcg
gagcacgaagtacaagcgctggcagaactcaatcacgtcaacattgtccaataccatagt
tgttgggagggagttgactatgatcctgagcacagcatgagtgatacaagtcgatacaaa
acccggtgcctctttattcaaatggaattctgtgataaaggaactttggagcaatggatg
agaaacagaaatcagagtaaagtggacaaagctttgattttggacttatatgaacaaatc
gtgaccggagtggagtatatacactcgaaagggttaattcacagagatcttaagccaggt
aatatatttttagtagatgaaagacacattaagatcggagactttggccttgcaacagcc
ctggaaaatgatggaaaatcccgaacaaggagaacaggaactcttcaatacatgagtcca
gaacagttatttttaaagcactatggaaaagaagtggacatctttgctttgggccttatt
ctagctgaacttcttcacacgtgcttcacggagtcagagaaaataaagtttttcgaaagt
ctaagaaaaggcgacttctctaatgatatattcgacaacaaagaaaaaagccttctaaaa
aaactactctcagagaaacccaaggaccgacctgagacatctgaaatcctgaagaccttg
gctgaatggaggaacatctcagagaaaaagaaaagaaacacatgttag

KEGG   Mus musculus (mouse): 27103
Entry
27103             CDS       T01002                                 

Gene name
Eif2ak4, 2610011M03, GCN, GCN2, MGCN2
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 4
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu05160  Hepatitis C
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27103 (Eif2ak4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    27103 (Eif2ak4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    27103 (Eif2ak4)
   05162 Measles
    27103 (Eif2ak4)
   05168 Herpes simplex virus 1 infection
    27103 (Eif2ak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    27103 (Eif2ak4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27103 (Eif2ak4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   27103 (Eif2ak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like APH
Other DBs
NCBI-GeneID: 27103
NCBI-ProteinID: NP_038747
MGI: 1353427
Ensembl: ENSMUSG00000005102
Vega: OTTMUSG00000015229
UniProt: Q9QZ05 A2AUM0
Structure
PDB: 
4OTN 1UKX

Position
2; 2 E5
AA seq 1648 aa
MAGGRGASGRGRAEPQESYSQRQDHELQALEAIYGSDFQDLRPDARGRVREPPEINLVLY
PQGLAGEEVYVQVELRVKCPPTYPDVVPEIDLKNAKGLSNESVNLLKSHLEELAKKQCGE
VMIFELAHHVQSFLSEHNKPPPKSFHEEMLERQAQEKQQRLLEARRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEITSLTNQDYASKRDPAGHRAAAILHGGSPDFVGNGKAR
TYSSGRSRRERQYSVCSGEPSPGSCDILHFSVGSPDQLMVHKGRCVGSDEQLGKVVYNAL
ETATGSFVLLHEWVLQWQKMGPCLTSQEKEKIDKCKRQIQGAETEFSSLVKLSHPNIVRY
FAMNSREEEDSIVIDILAEHVSGISLATHLSHSGPVPAHQLRKYTAQLLAGLDYLHSNSV
VHKVLSASSVLVDAEGTVKITDYSISKRLADICKEDVFEQARVRFSDSALPYKTGKKGDV
WRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFINP
QPKLPLVEQSPEDSGGQDYIETVIPSNQLPSAAFFSETQKQFSRYFIEFEELQLLGKGAF
GAVIKVQNKLDGCCYAVKRIPINPASRHFRRIKGEVTLLSRLHHENIVRYYNAWIERHER
PAVPGTPPPDCTPQAQDSPATCGKTSGDTEELGSVEAAAPPPILSSSVEWSTSAERSTST
RFPVTGQDSSSDEEDEDERDGVFSQSFLPASDSDSDIIFDNEDENSKSQNQDEDCNQKDG
SHEIEPSVTAEAVHYLYIQMEYCEKSTLRDTIDQGLFRDTSRLWRLFREILDGLAYIHEK
GMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFTAEGKQDDQAGDGVIKSDPSGHLTGM
VGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSPK
FPDDFDDGEHTKQKSVISWLLNHDPAKRPTAMELLKSELLPPPQMEESELHEVLHHTLAN
IDGKAYRTMMSQIFCQHISPAIDYTYDSDILKGNFLIRTAKIQQLVCETIVRVFKRHGAV
QLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIER
VFRPRKLDRFHPKELLECAFDIVTSTTNSSLPTAETIYTIYEIIQEFPALQERNYSIYLN
HTMLLKAILLHCGIPEDKLSQVYVILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKFI
EQKGDLQDLTPTINSLIKQKTGVAQLVKYSLKDLEDVVGLLKKLGVKLQVSINLGLVYKV
QQHTGIIFQFLAFSKRRQRVVPEILAAGGRYDLLIPKFRGPQTVGPVPTAVGVSIAIDKI
FAAVLNMEEPVTVSSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQE
YCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLESDLVDHVMQKLRTKVGDERNFR
DASDNLAVQTLKGSFSNASGLFEIHGTTVVPNVIVLAPEKLSASTRRRHEIQVQTRLQTT
LANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCD
EIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4947 nt   +upstreamnt  +downstreamnt
atggctgggggccgcggggcctctggacgcggccgggctgagccacaggagagctattcg
cagcgacaggaccacgagctgcaggccctggaggccatttacggctcggacttccaggat
ctgcggccggatgcgcgcggacgggtgagagagcctcctgaaatcaacttagttctttac
cctcagggcctagctggtgaagaagtatacgtgcaagtggaactgagggttaaatgccca
cctacatacccagatgtagttcccgaaatagacttaaaaaatgctaaaggcctgtcgaat
gaaagtgttaatttgttaaaatcacacctggaagaactggccaaaaagcagtgtggagag
gtgatgatatttgaactggcacaccatgtgcagtcgtttctcagcgagcataacaagccc
ccaccaaagtctttccatgaagaaatgctggaaaggcaggctcaggagaagcagcagagg
ttgctggaggccaggcggaaggaggagcaggagcaacgtgaaatcctccacgagattcag
agaaggaaagaggagatcaaggaagagaagaaaaggaaggaaatggctaagcaggaacgt
ttggaaatcactagcttgacaaaccaggactatgcctctaagagagacccagcagggcac
agggcagctgccatcctccatggaggctctcctgactttgtaggaaatggtaaagcccgg
acatactcctcaggaaggtccaggcgagaacgtcagtattctgtgtgtagtggtgaaccc
tctcctggctcgtgtgacatcctccatttctctgtgggtagccctgatcagctcatggtg
cacaaagggagatgtgttggcagtgatgagcagctgggaaaggtggtatacaatgctttg
gaaacagccacgggcagctttgtcttgctgcatgagtgggtccttcaatggcagaagatg
ggcccttgccttaccagtcaagagaaagagaagattgacaagtgcaaaaggcagattcaa
ggagcagaaacagaattcagctccctagtgaaactgagccatccaaatatcgtccgctac
tttgcgatgaactccagagaggaggaggactccattgtgatcgacattctggcagagcac
gtcagtggcatctctctggctacacacctgagccactcgggcccagtccccgcccaccag
ctgcgcaagtacacagcccagctcctggcaggcctggattacctacacagcaactccgtg
gtgcacaaggttctgagcgcgtccagtgtcttggtagatgccgagggcactgtcaagata
acagactacagcatctctaagcgtctggcagacatttgcaaggaggatgtatttgagcaa
gctcgagttcgttttagtgacagtgccctgccttataaaacaggaaagaaaggggatgtg
tggcggctcggcctcctgctgttgtctctcagccaaggacaggagtgtggggagtatccg
gtgaccatccccagtgacctgccagctgacttccaagacttcctgaagaagtgtgtctgc
ctggacgacaaggaaagatggagccctcagcagctgctgaaacacagctttataaaccct
caaccaaagctgcctttggtggagcagagtcctgaagactctgggggacaagactacatt
gagaccgtcattcccagcaaccagctgcccagcgctgcgttcttcagtgagacacagaaa
cagttctcccggtacttcattgagtttgaagaactacaactcctagggaaaggagctttt
ggagctgtcatcaaggtgcaaaacaagcttgatggctgctgctatgctgtgaagcgcatc
cctatcaaccctgcaagcagacacttccgccggatcaagggcgaggtgacactgctatcg
cgcctgcaccatgagaacattgtgcgctactacaacgcctggatcgagcggcatgagcgc
ccagcggtgccagggacaccgcccccagactgcacaccccaggcccaggacagcccagcc
acctgcgggaaaacatcaggcgacactgaagaactgggcagcgtggaggctgcagcaccg
ccacccatcctcagcagctcggtggagtggagcacatctgcagagcgttctaccagcacc
cgcttcccagtcacgggccaggattccagcagcgatgaggaggacgaggacgagcgcgat
ggcgtcttctcccagtcctttctacctgcttcagattctgacagtgacatcatctttgac
aatgaagatgaaaacagtaaaagtcaaaatcaggatgaagactgcaatcaaaaggacggt
agccatgagattgagccttcagtgacagctgaggctgtgcactacctttatatccagatg
gagtactgcgagaagagcacgctgcgggacaccattgaccaggggctgttccgagacacc
agccggctctggaggcttttccgagagattctggatggattagcttatatccatgagaaa
ggaatgattcatcgcgacttgaagcctgtcaatatttttttggattctgatgaccatgtg
aaaataggtgactttggcctggcaacagaccatctggccttcactgctgaaggtaaacag
gacgaccaggcaggtgacggagtgattaagtcagacccttcaggccatttgactggcatg
gttggtactgctctgtatgtaagccctgaggtccaaggaagcaccaagtctgcatacaac
cagaaagtggatctcttcagcctgggaattatcttctttgagatgtcttatcacccgatg
gtgactgcctcagaaagaattttcgttctcaaccaacttcgagatcccacatcgcccaag
tttccagacgacttcgatgatggagaacatacaaagcagaaatctgtcatctcctggctg
ttgaaccatgatccagctaaacggcccacggccatggaactgctcaagagtgagctgctc
cccccgccgcagatggaggagtccgagctgcatgaagtgctgcaccacacgctggccaac
atagatgggaaggcctaccgcaccatgatgagtcagatcttctgccagcacatctccccc
gctatagactacacctacgacagtgacatcctgaagggcaacttcttgattcgtacagcc
aagatccagcagcttgtatgtgaaaccatcgtccgcgtctttaaaaggcatggcgctgtc
cagctgtgcaccccactgctgcttccccgaaacaggcaaatatatgagcacaacgaagcg
gctttgttcatggatcacagcggcatgctggtgatgcttccgttcgacctgcgggtccct
tttgcaagatatgtggcaagaaataacatactgaatttaaaacgatactgcatagagcgg
gtgttcagacctcggaagttagaccgatttcatcccaaagaactcctggaatgtgcattt
gatatcgtcacttctaccaccaacagctctctgcccactgccgaaaccatctacaccatc
tatgaaataatccaggagtttcctgcacttcaggaaaggaattacagcatttacttgaac
catacgatgcttctgaaggcaatactcctacactgtgggatcccagaggacaagctcagc
caagtctacgtcattctgtatgatgctgtgacagagaagctgactaggagagaagtggaa
gctaaattctgtaacctgtccttgtcttctaatagcctgtgtagactctacaagttcatt
gagcagaagggggatttgcaagacttaacgccaaccatcaactcactaataaaacagaaa
acaggcgttgctcagttggtgaagtatagcttaaaagacctcgaggacgtcgtcgggctg
ctgaagaaacttggcgtgaagttacaggtctccatcaacctgggcttggtctacaaggtg
cagcagcacactggcatcatcttccagttcctggcattcagcaaacgcaggcaaagggtt
gtgcctgagatccttgccgccggtggcagatacgacctgctgattcccaagttcagaggc
ccacagactgtggggccagtccccactgctgtcggtgtcagcatagccatagacaagata
tttgctgctgtcctcaacatggaagagcctgttacagtgagctcctgtgacctcctggtt
gtcagtgttggccagatgtccatgtccagggccatcaacctaacccagaaactgtggaca
gcgggcatcactgcagaaatcatgtatgactggtcccagtcccaggaagagttacaagag
tactgcagacaccatgaaatcacctatgtggctctggtctccgataaagaaggaagccat
gtcaaggtcaagtcctttgagaaggagaggcaaacagaaaagcgtgtattggaatcggat
cttgtggatcacgttatgcagaaactaagaaccaaagttggtgacgaaagaaatttcaga
gacgcttctgataatcttgccgtacaaactctgaaggggtcgttttctaatgcttcaggt
ttgtttgaaatccatggaactacagtagtccccaacgtgattgttctagcaccagaaaag
ctgtcagccagcaccaggaggcgacatgagattcaggtgcaaacccgacttcagactaca
cttgccaacttacatcagaaaagcagtgaaattgaaattttggctgtggacctacccaag
gaaacaatcttacagtttctatcattagagtgggatgctgatgaacaggcatttaacaca
actgtgaagcagctgctgtcacgcctgccaaagcaaagatacctcaaactcgtctgcgat
gaaatttataacatcaaagttgaaaagaaggtgtcagtgctgttcctgtacagctacaga
gatgactactacagaatcctattttga

DBGET integrated database retrieval system