KEGG   Mus musculus (mouse): 13669Help
Entry
13669             CDS       T01002                                 

Gene name
Eif3a, A830012B05Rik, Csma, Eif3, Eif3s10, mKIAA0139
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    13669 (Eif3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    13669 (Eif3a)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    13669 (Eif3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 13669
NCBI-ProteinID: NP_034253
MGI: 95301
Ensembl: ENSMUSG00000024991
UniProt: P23116 Q3TRH1 Q3UM46
Position
19; 19 D3
AA seq 1344 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFSVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPVGPHLQSMPSEQIRNQLTAMSSVLAKALEVIRPA
HILQEKEEQHQLAVNAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRVK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHSRLEDRKRQRKEERKITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRETRDDERPHRRDEDRLRRLGGDDEERESSLRPDDDRIPRR
GLDDDRGPRRGPDEDRFSRRGTDDDRPSWRNADDDRPPRRIGDDDRGSWRHTDDDRPPRR
GLDDERGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGMDDDRGPR
RGLDDDRGPWRNAAEDRISRRGADDDRGPWRNMDDDRVPRRGDDARPGPWRPFVKPGGWR
EKEKAREESWGPPRESRPSEEREWDRDKEKDRDNQDREENDKDLERDRDRERDGDREDRF
RRPRDEGGWRRGPAEESSSWRDSSRRDDRDREDRRRDRDDRRDLRDLRDRRDLRDDRDRR
GPPLRSEREEASSWRRTDDRKDDRTEERDPPRRVPPPALSRDREREREREGEKEKASWRA
EKDRESLRRTKNETDEDGWTTVRR
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaatgccctcaagcgcgccaacgaatttcttgag
gttggcaaaaagcagcctgccctggatgttctttatgatgtaatgaaaagtaagaagcac
agaacatggcagaagatacatgagccaattatgctgaaatacttggaactgtgtgtggat
cttcgtaagagccacttggctaaggaagggttatatcaatataagaacatatgccaacag
gtaaacattaaatctttagaagatgttgttagggcatatttgaaattagcagaggaaaaa
acagaagctgctaaagaagagtcccaacaaatggtgttagatatagaagatctggataat
attcagactcctgagagtgttctcttaagtgcagtaagtggggaagatactcaggatcgt
actgacagattgctactgactccctgggtcaagttcctgtgggaatcatacaggcagtgt
ttggaccttcttcgaaacaattctagagtagagcgcctttaccatgatatcgcccaacaa
gctttcaaattctgcctccagtatactcggaaggctgagttccgcaagctatgtgacaac
ttgcgaatgcacttatcccagattcagcgccaccataaccaaagcacagcaattaatctt
aataatccagagagccagtctatgcatttggaaaccagacttgttcagttggacagtgct
atcagcatggaattatggcaggaagccttcaaagctgtggaagatattcatggactattt
tccttgtctaagaaaccacctaagcctcagttgatggcaaattactataacaaagtttca
acagtgttttggaaatctggaaatgctttgttccatgcatctacacttcatcgtctttat
catctgtctagagaaatgagaaagaatcttacacaagaagagatgcaaagaatgtctact
agagtccttttggcgactctttccattcctattactcctgagcgaactgatattgctcga
cttttggatatggatggtattatagttgagaagcagcgacgccttgccacattgctaggt
cttcaagccccacccacacgaatcggcctaattaatgatatggtcaggttcagtgtgcta
cagtatgttgtcccagaagtgaaagacctttacaactggttggaggtggaattcaaccca
ctaaaactctgtgagagagttacaaaggtattaaattgggttagggaacaacctgaaaaa
gaaccagaattgcaacaatatgtaccacaactccagaacaataccatactccgccttctg
caacaggtggcacagatttatcagagcattgagttttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgcagccaggcactgtgacctg
caggtacgtattgaccatacttcccggactctgagttttggatcagatttgaattatgca
actcgagaagatgccccagttggccctcatctgcagagcatgccttcagagcagataaga
aaccagctcacggccatgtcctcagtgcttgccaaagcacttgaagtcatcagacctgct
cacattctgcaagagaaagaagaacagcatcaattggcagttaatgcatatcttaaaaat
tcaagaaaagagcaccagaggatcctggctcggagacagacaattgaggaaagaaaagag
cgtcttgagagtctgaatattcaacgtgagaaggaagaactcgagcagagggaagctgaa
ctccagaaagtacgaaaggctgaagaagaaaggctgcgccaagaggcaaaggagcgagag
aaggaacgaatccttcaagaacacgagcaaatcaagaagaaaactgttcgggagcggtta
gagcagatcaagaagacagagctgggcgccaaagcatttaaagatattgacattgaagac
cttgaagaactggatccagattttattatggccaaacaggttgaacaactggagaaagaa
aagaaggaacttcaggaacgcctgaagaatcaagaaaagaagattgactattttgagaga
gctaagcgtttggaagaaattcctttaataaagagtgcttatgaggaacaaagggttaaa
gacatggacctgtgggaacagcaagaagaagaaagaatcactacaatgcagctagaacga
gaaaaagctctggagcataagaataggatgtcacgaatgttggaagacagagatctattt
gtgatgcgcctcaaagctgcccggcagtctgtctacgaggaaaaactgaaacagtttgaa
gagcgcttagcagaagaaaggcatagtcgcctagaagatcggaaaaggcagcggaaagaa
gaacgcaaaataacttattacagagaaaaggaagaagaagagcagaggagggcagaggag
cagatgctcaaagagcgagaagaaagagaacgtgctgagagagcaaaacgggaggaagaa
cttagagagtatcaggagcgagtcaagaaactagaagaagtagaaaggaaaaagcggcaa
agagagctggaaattgaagaaagggaaaggcgcagagaggaagaaaggagacttggtgat
gatccactttctaggaaggactctcggtggggagatagagattcagaaggcacctggagg
aaaggaccagaagctgactctgagtggagaagaggcccaccagaaaaggagtggagacga
gaaactcgggatgatgagaggcctcacaggagagatgaggatcggctgaggcgcttgggg
ggtgacgatgaagagagagagtcttctcttagaccggatgatgatcgtatccccaggcgt
ggcctggatgatgacagagggcctagacgtggtcccgatgaagatagattttctcgtaga
ggaacagatgatgaccgtccttcctggcgtaatgcagatgatgataggcctcccaggcga
attggtgatgatgacaggggaagctggcgtcacacagatgacgacagaccacccagacgg
ggactggatgatgagagaggaagctggcgtacagcagatgaggacagaggacctagacga
gggatggatgatgaccgggggccaagacgaggaggtgctgatgatgaacggtcatcctgg
cggaatgctgatgatgataggggtcccaggagaggcatggatgatgataggggtcccagg
cgagggctggatgatgaccgaggaccttggaggaatgctgctgaagataggatttccagg
agaggtgcagatgatgaccgagggccttggagaaatatggatgatgatagggttcctaga
aggggtgatgatgcaagacctggtccttggagaccatttgtcaagccaggtggatggaga
gagaaagaaaaggctagagaagagagttggggtccacctcgagaatcaagaccatcagaa
gaacgtgaatgggatagagacaaagagaaggacagagataatcaagatcgagaggagaat
gacaaagaccttgaacgagatagggacagagagagagatggggaccgggaggatcgattc
agaagacccagggatgaaggtggctggagaagaggaccagcagaagaatcttcaagctgg
agagattcaagtcgccgtgatgatagggacagggaagaccgtcgacgggatagagatgat
cgtcgtgatctgagagacctgagagacagaagggatttaagagatgatagagatcggaga
ggacctcccctcagatcagagcgagaagaagcaagctcttggagacgcactgatgacagg
aaagatgaccggactgaagagagggatccacctcgtcgtgttcctcccccagctctttca
agagatcgagaaagagagcgagaacgagaaggtgagaaagagaaagcatcctggagagct
gagaaagatagggagtcccttcgtcgtactaagaatgaaactgatgaagatggatggacc
acagtacgacgttaa

DBGET integrated database retrieval system