KEGG   Mus musculus (mouse): 13684
Entry
13684             CDS       T01002                                 

Gene name
Eif4e, EG668879, Eif4e-ps, If4, If4e, eIF-4, eIF-4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu03013  RNA transport
mmu04066  HIF-1 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04211  Longevity regulating pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    13684 (Eif4e)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    13684 (Eif4e)
   04151 PI3K-Akt signaling pathway
    13684 (Eif4e)
   04150 mTOR signaling pathway
    13684 (Eif4e)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    13684 (Eif4e)
  09149 Aging
   04211 Longevity regulating pathway
    13684 (Eif4e)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13684 (Eif4e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13684 (Eif4e)
   03012 Translation factors [BR:mmu03012]
    13684 (Eif4e)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     13684 (Eif4e)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     13684 (Eif4e)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    13684 (Eif4e)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 13684
NCBI-ProteinID: NP_031943
MGI: 95305
Ensembl: ENSMUSG00000028156
Vega: OTTMUSG00000052912
UniProt: P63073 Q8C470 Q3TK95
Structure
PDB: 

Position
3 G3; 3 64.3 cM
AA seq 217 aa
MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctaccactaatcccccacctgcagaagaggaa
aaaacagagtctaatcaggaggttgctaacccagagcactatattaaacaccctctacag
aacaggtgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cgattgatctctaagtttgatactgttgaagacttttgggctctatacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggacgggattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacggtggctgatcacactgaacaagcag
cagagacggagtgacctcgatcgcttctggctagagacactgctgtgccttattggagaa
tctttcgatgactacagtgatgatgtgtgtggagctgttgttaatgttagagctaaaggt
gataagatagcaatatggactactgagtgtgaaaacagagatgcagtcacacacataggg
agggtatacaaggaaaggttaggacttcctccgaagatagtgattggttatcagtcccac
gcagacacagctacaaagagcggctccaccactaaaaataggtttgttgtttaa

KEGG   Mus musculus (mouse): 218268
Entry
218268            CDS       T01002                                 

Gene name
Eif4e1b, Eif4, Eif4eloo, Gm273
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 1B
  KO
K03259  translation initiation factor 4E
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu03013  RNA transport
mmu04066  HIF-1 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04211  Longevity regulating pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    218268 (Eif4e1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    218268 (Eif4e1b)
   04151 PI3K-Akt signaling pathway
    218268 (Eif4e1b)
   04150 mTOR signaling pathway
    218268 (Eif4e1b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    218268 (Eif4e1b)
  09149 Aging
   04211 Longevity regulating pathway
    218268 (Eif4e1b)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    218268 (Eif4e1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    218268 (Eif4e1b)
   03012 Translation factors [BR:mmu03012]
    218268 (Eif4e1b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     218268 (Eif4e1b)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     218268 (Eif4e1b)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    218268 (Eif4e1b)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 218268
NCBI-ProteinID: NP_001028441
MGI: 2685119
Ensembl: ENSMUSG00000074895
Vega: OTTMUSG00000032677
UniProt: Q3UTA9
Position
13; 13 B1
AA seq 244 aa
MNKVEGGGHKEEVVVKEKEVVKEKPSEATAEGVQAGEAKDLPGSLKTQRRKAHREHPPEV
LSKLHPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYA
LFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGA
VVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKSNNLAN
KFVV
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaacaaagttgagggtggagggcataaggaggaggtggtggtgaaagaaaaggaggta
gtgaaagaaaagccatcagaagcaactgcggagggagtccaagcaggagaagccaaagac
cttcctggctcccttaagactcagaggaggaaggcccacagagaacatccaccagaggtc
ctgagcaagctacaccccttgcagtacaggtgggttctgtggttcttcaagaatgaccga
agccgggcctggcaggacaacctgcagctagtcaccaagtttaacactgtggaggacttc
tgggcggtgtacagccatatcaagctggccagcaagctctcttccggctgtgactatgcc
ctgttcaaggaaggcatcctgcccatgtgggaagacaacagaaacaagcagggtggccgc
tggctgctcagcattgacaaacaactgcgccacttcgaactggaccgtctgtggctggag
acgttgctgtgtctggttgggaattgttttgaggaatacagcagggaagtgtgcggtgct
gtcgtgaacatccgcacgaagagggacaagattgccctgtggacgagtgaagcagaggac
aaagccggagtgatgcagatcgggcaaatatacaaagagcgcctgggcatctctacgaag
accatcattgggtaccaggcccatgcagacactgctgccaagagcaacaacttagcaaac
aagtttgtggtgtga

KEGG   Mus musculus (mouse): 26987
Entry
26987             CDS       T01002                                 

Gene name
Eif4e2, 2700069E09Rik, AI036339, AV129531, D0H0S6743, D0H0S6743E, Eif4e, Eif4el3
Definition
(RefSeq) eukaryotic translation initiation factor 4E member 2
  KO
K03259  translation initiation factor 4E
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu03013  RNA transport
mmu04066  HIF-1 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04211  Longevity regulating pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    26987 (Eif4e2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    26987 (Eif4e2)
   04151 PI3K-Akt signaling pathway
    26987 (Eif4e2)
   04150 mTOR signaling pathway
    26987 (Eif4e2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    26987 (Eif4e2)
  09149 Aging
   04211 Longevity regulating pathway
    26987 (Eif4e2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    26987 (Eif4e2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    26987 (Eif4e2)
   03012 Translation factors [BR:mmu03012]
    26987 (Eif4e2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     26987 (Eif4e2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     26987 (Eif4e2)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    26987 (Eif4e2)
SSDB
Motif
Pfam: IF4E Stm1_N
Other DBs
NCBI-GeneID: 26987
NCBI-ProteinID: NP_001034259
MGI: 1914440
Ensembl: ENSMUSG00000026254
Vega: OTTMUSG00000021766
UniProt: Q8BMB3
Position
1; 1 C5
AA seq 245 aa
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcgacgccttaaaagatgatgacagtggagaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacagaccgagacaagagccagagc
agtggcaagaggaaggctgttgtccctggaccagcagagcatcccctgcagtacaactac
accttttggtactcgaggagaacccctggccgtcccaccagctcgcagagctatgagcag
aacatcaagcagattggcacctttgcctctgtggagcagttctggaagttttacagccac
atggtacgtcctggggacctgacaggccacagtgactttcatctcttcaaagaagggatt
aaacctatgtgggaggatgatgcaaataaaaatgggggcaagtggatcattcgactccgg
aagggcttagcttcccgctgctgggagaatctcatcctggctatgctcggggagcaattc
atggttggggaggagatctgcggggctgtggtctctgtccgctttcaggaggacattatt
tctatatggaataagactgccagcgaccaagcaactacagcccgaatccgggatactctt
cggcgcgtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cgattgaatgtgccatga

DBGET integrated database retrieval system