KEGG   Mus musculus (mouse): 13688
Entry
13688             CDS       T01002                                 

Gene name
Eif4ebp2, 2810011I19Rik, 4E-BP, 4E-BP2, AA792569, BC010348, PH, PHAS-II
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 2
  KO
K18644  eukaryotic translation initiation factor 4E binding protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    13688 (Eif4ebp2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    13688 (Eif4ebp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13688 (Eif4ebp2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     13688 (Eif4ebp2)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 13688
NCBI-ProteinID: NP_034254
MGI: 109198
Ensembl: ENSMUSG00000020091
UniProt: P70445 Q3UFP6
Position
10 B4; 10 32.21 cM
AA seq 120 aa
MSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLL
DRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtccgcgtcggccggtggtagccaccagcccagccagagccgcgccatccccacgcgc
accgtggctatcagcgacgccgcgcagctacctcaggactactgcaccacgcccgggggg
acgctgttctccacaacgccgggaggaacacgaatcatttatgaccgaaagtttctgttg
gaccgtcgcaattctcccatggcgcagaccccaccttgccatctgcccaatatccctgga
gtcaccagtcctggcgccttaattgaagactccaaagtagaagtgaacaacttaaacaac
ctgaacaatcatgacaggaagcatgcagttggggatgaggctcagtttgagatggacatc
tga

DBGET integrated database retrieval system