KEGG   Mus musculus (mouse): 13690Help
Entry
13690             CDS       T01002                                 

Gene name
Eif4g2, DAP-5, E130105L11Rik, Nat1, Natm1, p97
Definition
(RefSeq) eukaryotic translation initiation factor 4, gamma 2
  KO
K03260  translation initiation factor 4G
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05416  Viral myocarditis
Module
mmu_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    13690 (Eif4g2)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    13690 (Eif4g2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13690 (Eif4g2)
   03012 Translation factors [BR:mmu03012]
    13690 (Eif4g2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     13690 (Eif4g2)
   mRNA cycle factors
    Stress granule specific factors
     13690 (Eif4g2)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    13690 (Eif4g2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIF4G W2 MA3
Motif
Other DBs
NCBI-GeneID: 13690
NCBI-ProteinID: NP_038535
MGI: 109207
Ensembl: ENSMUSG00000005610
Vega: OTTMUSG00000035134
UniProt: Q62448 A0JNY7
Position
7 E3; 7 58.0 cM
AA seq 906 aa AA seqDB search
MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDD
NSAANNSANEKERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVD
KALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTR
NVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKK
RVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFARMCSLMLSKELPARIRFLLQD
TVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGRNDFFLEGPFMPPRM
KMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQ
FGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSFL
MNKNQVPKLQPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPLIQEKPAKTSKKPPPSK
EELLKLTEAVVTDYLNSGNANDAVSGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKAS
SLISLLKQEGIATSDNFMQAFLNVLEQCPKLEVDIPLVKSYLAQFAARAIISELVSISEL
AQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEG
KGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYIS
SEVSPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNS
SFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEE
SEEEAD
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
gtggagagtgcgattgcagaagggggtgcttctcgtttcagtgcttcttcgggcggagga
ggaagtaggggtgcacctcagcactatcccaagactgctggcaacagcgagttcctgggg
aaaaccccagggcaaaacgctcagaaatggattcctgcacgaagcactagacgagatgac
aactccgcagcaaacaactccgcaaatgaaaaagaacgacatgatgcaatcttcaggaaa
gtaagaggcatactaaataagcttactcctgaaaagtttgacaagctatgccttgagctc
ctcaatgtgggtgtagagtctaaactcatccttaaaggggtcatactgctgattgtggac
aaagccttagaagagccaaagtatagctcgctgtatgctcagctatgtctgcgattggca
gaagatgcaccaaactttgatggcccagcagcagagggtcaaccaggacagaagcaaagc
acaacattcagacgcctcttgatttccaaattgcaagatgaatttgaaaaccgaaccaga
aatgttgatgtctatgataagcgtgaaaatcccctccttcctgaggaggaggaacagaga
gccattgctaagatcaagatgttggggaacatcaaattcattggagaacttggcaagctt
gatcttattcatgaatctatccttcataagtgcatcaaaacacttttggaaaagaagaag
agagtccaactcaaagatatgggagaggatttggagtgcctctgtcagataatgaggaca
gtgggacctcgattagaccatgaacgagccaagtccttaatggatcagtactttgccaga
atgtgttccttaatgttaagtaaggaattgccagccaggattcgtttcctactgcaggat
actgtagagttgcgagagcaccattgggttcctcgcaaggcttttcttgacaatggacca
aagacgatcaatcaaatccgtcaagatgcagtaaaagatctaggagtgtttattcctgct
cctatggctcaagggaggaatgacttcttcctggagggaccgttcatgccgccaaggatg
aaaatggatagggacccacttgggggacttgctgatatgtttggacaaatgccaggtagt
ggaattggtactggtccaggagttatccaggatagattttcacccacaatgggacgtcat
cgttcaaatcagctcttcaatggccatggggggcacatcatgcctcccacgcaatcgcag
tttggagagatggggggcaagtttatgaaaagccaggggctaagccagctctaccataac
cagagtcagggactcttatcccagctacaaggacagtcgaaggatatgccacctcggttt
tctaagaaaggacagcttaatgcagatgagattagtttgaggcctgctcagtcgtttcta
atgaataaaaatcaggtgccaaagcttcagccccagataactatgattcctcccagtgca
cagccaccacgcactcaaacaccgcctctgggacagacacctcaacttggtctcaaaact
aatccaccacttatccaggaaaagcctgccaagactagcaaaaagccaccaccatcaaag
gaagaactacttaaactgaccgaagccgttgtgactgactatctgaacagtggaaatgcc
aacgacgctgtcagtggtgtgagagaaatgagagctccaaaacactttcttcctgagatg
ctaagcaaagtgatcatcctgtcacttgatagaagtgatgaagataaagaaaaagcaagc
tctttaatcagtttactcaaacaggaagggatagccacaagtgacaacttcatgcaggct
ttcctgaatgtattggagcagtgccccaaactggaggttgacatccccttggtgaaatct
tacttggcacagtttgcagctcgtgctataatttcagagttggtgagcatttccgaacta
gctcaaccactggagagtggcacccacttccctctcttcttactttgtcttcaacaatta
gctaaattgcaagaccgagagtggttaaccgaactttttcaacaaagcaaggtcaatatg
cagaaaatgctgccagaaattgatcagaataaggatcgaatgttggagattttggaagga
aagggactgagtttcttattcccactccttaaattggagaaggaactattgaagcaaatt
aagctggatccatcccctcaaactatatataaatggattaaagataacatctctcccaaa
cttcatgtagataaaggattcgtgaacatcttaatgaccagcttcttacagtacatttct
agtgaagtaagcccacccagcgatgaaacagattcttcctctgctccttccaaagagcag
ttagagcaggaaaaacagctgctgctctcttttaagccagtgatgcagaaatttcttcat
gatcatgtggatctacaggtcagtgccctgtatgctttgcaggtgcactgttacaacagc
agcttcccaaaaggcatgttacttcgattttttgttcacttctatgacatggaaattatt
gaagaggaagctttcttagcttggaaggaagacataactcaagagtttccaggaaaaggc
aaggctttgttccaggtgaatcagtggctaacctggctagaaactgctgaagaagaagaa
tcagaggaagaagctgactaa

DBGET integrated database retrieval system