KEGG   Mus musculus (mouse): 13710
Entry
13710             CDS       T01002                                 

Symbol
Elf3, ESE-1, ESX, jen
Name
(RefSeq) E74-like factor 3
  KO
K09429  E74-like factor 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13710 (Elf3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    13710 (Elf3)
SSDB
Motif
Pfam: Ets SAM_PNT AT_hook
Other DBs
NCBI-GeneID: 13710
NCBI-ProteinID: NP_001156603
MGI: 1101781
Ensembl: ENSMUSG00000003051
Vega: OTTMUSG00000049800
UniProt: Q3UPW2
Structure
PDB: 
3JTG

Position
1; 1 E4
AA seq 391 aa
MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTLEGPGPQTRSQ
RDRTDPLAVLHLAEKASWTSERPQFWSKTQVLEWISYQVEKNKYDASSIDFSRCDMDGAT
LCSCALEELRLVFGPLGDQLHAQLRDLTSNSSDELSWIIELLEKDGMSFQESLGDSGPFD
QGSPFAQELLDDGRQASPYYCSTYGPGAPSPGSSDVSTARTATPQSSHASDSGGSDVDLD
LTESKVFPRDGFPDYKKGEPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR
DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKRE
ILERVDGRRLVYKFGKNSSGWKEEEVGESRN
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggctgccacctgtgagatcagcaacgtttttagtaactacttcaacgccatgtacagc
tcagaagaccccaccctggctcctgctcctccgactacctttggcactgaagacttggtg
ttgaccctgaacaaccaacagatgacactggaaggtccaggacctcagacaagatcccaa
agggacaggactgatcctctggctgtactccaccttgcagagaaggcaagctggactagc
gagcggccccagttctggtcgaagacccaggttctggagtggatcagctaccaagtggag
aagaacaagtatgacgccagctccatcgacttctcccgctgcgacatggacggagccacc
ctctgcagctgtgcgctggaggagctgcggctagtctttggacctctgggagaccagctc
catgcccagcttcgggacctcacctccaactcttctgatgaactcagctggatcatcgag
ctgctggagaaggatggcatgtccttccaagagagcctaggcgactcgggcccctttgat
cagggaagtccttttgcccaggaactcctggatgatggccgccaggccagtccctactac
tgcagtacctatggccctggagcgccctcccccggcagctctgatgtctccactgcaagg
accgctactccccagagttcccatgcttctgactccggtggaagtgatgtggacctggac
ctcaccgagagcaaggtcttccctagagatggctttcctgactataagaagggggaaccc
aagcacgggaagaggaaacgggggcgtcccagaaagctgagcaaggaatactgggactgt
ctggagggcaagaagagcaagcacgcccccagaggtactcacctgtgggagtttatccga
gacatcctaatccaccccgagctcaacgaaggcctcatgaagtgggagaaccggcacgag
ggtgtgttcaagtttcttcgctcagaggccgtggcccaactctggggccagaagaagaag
aacagcaacatgacctatgagaagctgagccgagccatgaggtattactacaaacgggag
atcctggaacgggtggatggccgacggctcgtctacaagtttggcaagaactctagtggc
tggaaggaagaagaggttggagagagtcggaattaa

DBGET integrated database retrieval system