KEGG   Mus musculus (mouse): 13723
Entry
13723             CDS       T01002                                 

Symbol
Emb, AL022799, Gp7, Gp70
Name
(RefSeq) embigin
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 V-set ig Ig_4
Other DBs
NCBI-GeneID: 13723
NCBI-ProteinID: NP_034460
MGI: 95321
Ensembl: ENSMUSG00000021728
Vega: OTTMUSG00000015373
UniProt: P21995
Position
13; 13 D2.3
AA seq 330 aa
MRSHTGLRALVAPGYPLLLLCLLAATRPDPAEGDPTDPTFTSLPVREEMMAKYSNLSLKS
CNISVTEKSNVSVEENVILEKPSHVELKCVYTATKDLNLMNVTWKKDDEPLETTGDFNTT
KMGNTLTSQYRFIVFNSKQLGKYSCVFGEKELRGTFNIHVPKAHGKKKSLIAYVGDSTVL
KCVCQDCLPLNWTWYMGNETAQVPIDAHSNEKYIINGSHANETRLKIKHLLEEDGGSYWC
RATFQLGESEEQNELVVLSFLVPLKPFLAILAEVILLVAIILLCEVYTHKKKNDPDAGKE
FEQIEQLKSDDSNGIENNVPRYRKTDSADQ
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcgctcgcacactggcctgagggcgcttgtggcgcctggttacccgctcctccttcta
tgtcttctggcggcgacgcgccctgatccggctgagggcgatcccacagatccaactttt
acaagtctacctgttcgagaagaaatgatggcgaaatactcaaacctttccttaaagagc
tgtaatatctcagtgacggaaaagtccaatgtatcagtagaagagaacgtaattttggaa
aagccttctcatgtggaactcaaatgcgtgtacacagcaactaaggatttgaacttgatg
aatgtgacttggaagaaagatgatgagccccttgagactacgggtgacttcaatacaact
aaaatgggcaacaccttaaccagtcagtacaggttcatcgtttttaatagcaaacaattg
ggaaaatattcttgtgtctttggagaaaaggaactaagagggacctttaacatccacgta
cccaaagctcatgggaaaaaaaagtcgttgatcgcttacgtgggggattctactgtgctg
aagtgtgtatgtcaagattgtcttcctttaaattggacttggtacatgggtaatgaaacc
gcacaggttcccattgacgctcactcgaatgaaaagtatatcatcaatggttcccatgcc
aatgaaacaaggctcaagattaagcatcttttggaggaagatggaggatcctactggtgt
cgtgccaccttccagttaggggagagtgaggagcagaatgagctggttgtgctgagcttc
ctggtgcccctcaagccatttctggccatacttgccgaagtcatcctcttggtggccatc
attctgctttgtgaagtgtacacacacaagaaaaagaatgacccagatgctgggaaagaa
tttgaacaaattgaacagctgaaatcagatgatagcaatggcatagaaaacaatgtcccc
cggtacagaaaaactgactctgcagatcagtga

DBGET integrated database retrieval system