KEGG   Mus musculus (mouse): 13726
Entry
13726             CDS       T01002                                 

Gene name
Emd, AW550900, Sta
Definition
(RefSeq) emerin
  KO
K12569  emerin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    13726 (Emd)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    13726 (Emd)
   05414 Dilated cardiomyopathy
    13726 (Emd)
SSDB
Motif
Pfam: LEM
Other DBs
NCBI-GeneID: 13726
NCBI-ProteinID: NP_031953
MGI: 108117
Ensembl: ENSMUSG00000001964
Vega: OTTMUSG00000017684
UniProt: O08579 A2AM95
Position
X A7.3; X 37.92 cM
AA seq 259 aa
MDDYAVLSDTELAAVLRQYNIPHGPIVGSTRKLYEKKIFEYETQRRRLLPPNSSSSSFSY
QFSDLDSAAVDSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTKTYGEPESVGMSKSFRQ
PGTSLVDADTFHHQVRDDIFSSLEEEGKDRERLIYGQDSAYQSIAHYRPISNVSRSSLGL
SYYPTSSTSSVSSSSSSPSSWLTRRAIRPEKQAPAAALGQDRQVPLWGQLLLFLVFAAFL
LFVYYSIQAEEGNPFWMDP
NT seq 780 nt   +upstreamnt  +downstreamnt
atggacgactatgcggttttgtccgatactgagctggccgcagtgctacgccagtacaac
atccctcatgggcctattgtgggttccactcgcaagctctacgaaaagaaaatcttcgag
tacgagacccagagaaggagactcttaccccccaactcgtcatcttcttcattctcctat
cagttctcagacttggattcagccgccgtggactcagacatgtatgatctgcccaaaaaa
gaagacgccttactttaccagagcaaggactataatgatgactactatgaggagagttat
ttgaccaccaagacatacggggagcctgagtctgtgggcatgtccaagagcttccgccag
ccggggacctcacttgtagatgctgataccttccatcaccaggtgcgtgatgacattttc
tcttctttagaagaggaaggcaaggatagggagcgcctcatctatggccaagacagtgcc
taccagagcatcgcacactaccgccccatttccaatgtctccaggagctctctgggctta
tcatattatcctacatcctccacctcttctgtgtcctcctcttcatcttctccctcttca
tggcttacccgacgtgccattcggccagagaagcaggcccctgctgctgctctgggccag
gatcgacaggtcccactctggggccagctgttactcttcctggtctttgctgcctttctg
ctctttgtttactattccatacaagctgaagaaggcaaccccttctggatggatccctaa

DBGET integrated database retrieval system