KEGG   Mus musculus (mouse): 13728Help
Entry
13728             CDS       T01002                                 

Gene name
Mark2, EMK-1, Emk, Par-1, Par-1b
Definition
(RefSeq) MAP/microtubule affinity regulating kinase 2
  KO
K08798  MAP/microtubule affinity-regulating kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13728 (Mark2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   13728 (Mark2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     13728 (Mark2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr KA1 Kinase-like UBA UBA_2 RIO1 Haspin_kinase Kdo DUF702
Motif
Other DBs
NCBI-GeneID: 13728
NCBI-ProteinID: NP_031954
MGI: 99638
Ensembl: ENSMUSG00000024969
Vega: OTTMUSG00000035747
UniProt: Q05512 E9QMP6
Position
19 A; 19 5.32 cM
AA seq 776 aa AA seqDB search
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMLRGRNSATSADEQPHIGNYRLLKTIG
KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRSSDQAVPAIPTSN
SYSKKTQSNNAENKRPEEETGRKASSTAKVPASPLPGLDRKKTTPAPSTNSVLSTSTNRS
RNSPLLDRASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHPNKA
SGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSSGAPDRTNFPRGVSSRSTFHAGQLR
QVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLNEPESKDRVETLRPHV
VGSGGTDKDKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHERYM
LLCVHGTPGHENFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgctcggacccccctacccacgctgaacgaaagggacacggagcagcccacc
ttgggacaccttgattccaagcccagcagtaagtccaacatgctgcggggccgcaactca
gccacctctgctgacgagcagccccatattggcaactaccggctccttaagaccattggc
aagggtaactttgccaaggtgaagttggcccggcacatcctgacggggaaagaggtagct
gtgaagatcatcgacaagacccagctgaactcctccagcctacagaaactgttccgagaa
gtaagaataatgaaggttttgaatcatcccaacatagttaagttgtttgaagtgatcgag
actgagaagactctctaccttgtcatggagtatgccagtggcggagaggtgtttgattac
ctagtggcccatggcaggatgaaagaaaaagaagctcgagccaaatttcgccagatagtg
tctgctgtgcagtactgtcaccagaagttcattgttcatagagatctaaaggcagaaaac
ctgctcctggatgctgatatgaacatcaagattgcagactttggctttagcaacgaattc
acctttgggaacaagctggatactttctgtggcagtcctccttatgctgccccagaactt
ttccagggcaaaaagtatgatggtcctgaggtggatgtctggagcctgggagtcatcctc
tatacactggtcagcggatccctgccttttgatggacagaacctcaaggagctgcgggaa
cgggtactgagggggaaataccgtattccgttctacatgtccacggactgtgaaaatctg
cttaagaaatttctcatacttaatcctagtaagagaggcactttagagcaaattatgaaa
gatcggtggatgaacgtggggcatgaggacgatgagctaaagccttatgtggaacctctc
cctgactacaaggacccccggcggacagagttgatggtgtcaatgggttacacacgggaa
gagatccaggactcgctggtaggccagaggtacaacgaagtgatggctacctatctgctc
cttggctacaagagctctgagctggaaggtgataccatcactttgaagccccggccttca
gctgatctaaccaacagcagtgccccatctccatcccacaaggttcagcgcagcgtctct
gccaaccccaagcaacgacgctccagtgaccaggccgtccctgccattcccacctcgaat
tcctactctaagaagactcagagtaacaacgcagaaaataagcggcctgaggaagagaca
gggcggaaagccagcagcaccgccaaagtgcctgccagccctctgcctggcctggacagg
aagaagaccactcctgccccctccacgaacagcgtcctttccaccagcacaaaccgaagc
aggaactccccacttttggacagggccagccttggccaggcctccatccagaatggtaaa
gacagcctaaccatgccagggtcccgggcctccacggcttctgcttctgccgcagtctct
gcggcccggccccgccagcaccagaaatccatgtctgcctccgtacaccccaacaaggcc
tctgggttgccccccacggagagtaactgtgaggtgcctcggcccagcacagccccccag
cgcgtccctgtcgcctccccctccgcccacaacatcagcagcagtagtggagccccagac
cgaactaatttcccacggggtgtgtccagtcgaagcaccttccatgctgggcagctccga
caggtgcgggaccagcagaatctaccctacggtgtgaccccagcctctccctctggccat
agccagggccggcggggggcctctggcagcatcttcagcaagttcacctccaagtttgtc
cgcaggaacctgaatgaacctgaaagcaaagaccgagtggagacgctcagacctcacgtg
gtaggcagtggaggcactgacaaggacaaggaggagtttcgggaggccaagcctcgctcc
ctgcgcttcacctggagcatgaagaccacgagctctatggagcccaatgagatgatgcgg
gagatccgcaaggtgctggacgccaacagctgccaaagcgagctgcacgagcggtacatg
ctactgtgcgtgcatggcacaccaggccacgagaactttgtgcagtgggagatggaggtg
tgcaaactgccccggctgtctctcaacggtgttcggtttaagcggatatcgggcacttcc
atggccttcaaaaacattgcctccaaaatagccaatgagctgaagctttaa

DBGET integrated database retrieval system