KEGG   Mus musculus (mouse): 13807
Entry
13807             CDS       T01002                                 

Symbol
Eno2, AI837106, D6Ertd375, D6Ertd375e, Eno, Eno-2, N, NSE
Name
(RefSeq) enolase 2, gamma neuronal
  KO
K01689  enolase [EC:4.2.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
mmu03018  RNA degradation
mmu04066  HIF-1 signaling pathway
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00002  Glycolysis, core module involving three-carbon compounds
mmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    13807 (Eno2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    13807 (Eno2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    13807 (Eno2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13807 (Eno2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13807 (Eno2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     13807 (Eno2)
Messenger RNA biogenesis [BR:mmu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     13807 (Eno2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   13807 (Eno2)
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C IAT_beta
Other DBs
NCBI-GeneID: 13807
NCBI-ProteinID: NP_038537
MGI: 95394
Ensembl: ENSMUSG00000004267
Vega: OTTMUSG00000022240
UniProt: P17183 Q545V3
Position
6 F2; 6 59.17 cM
AA seq 434 aa
MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGK
GVLKAVDHINSRIAPALISSGISVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCK
AGAAERDLPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRD
AMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKM
VIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLGALYQDFVRNYPVVSIEDPFDQDD
WAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLA
QENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtctatagagaagatttgggcccgagagatcttggactcccgtgggaatcccaccgtg
gaggtggatctctatactgccaaaggtcttttccgggctgcagtccccagtggagcctcc
accggcatctatgaggccctggaactaagggatggggacaaacagcgttacttaggcaaa
ggtgtcctgaaggcagtggaccacatcaacagcaggattgcaccagccctcatcagctca
ggtatctccgtggtggagcaggagaaactggacaacctgatgttggaactggatgggact
gagaataaatccaagtttggggccaatgccatcctgggtgtgtccctggccgtgtgtaag
gctggggcagctgagagggacttgcccctctatcgccacattgctcagctagctgggaac
tccgacctcatcctgcctgtgccggcctttaatgtgatcaatggtggctctcatgctggg
aacaagttggccatgcaggagttcatgatcctcccagtgggtgctgagagctttcgggat
gccatgcgacttggggcagaggtgtaccacaccctcaagggggtcatcaaggacaagtat
ggcaaggatgccactaacgtgggggatgaaggcggctttgcccccaatatcctggagaac
agcgaagccttggagctggtgaaggaagccatcgacaaggctggctacacggaaaagatg
gtgatcggtatggatgtggctgcctctgagttttaccgcgatggcaaatacgacttggat
ttcaagtctcccgctgatccttcccgatacatcactggggaccagctgggggcactctac
caggactttgtccggaactatcctgtggtctccattgaagacccatttgaccaggacgac
tgggcagcttggtccaagttcacagccaacgtcggcatccagatagtgggcgatgacctg
acggtgaccaaccccaagcgcatcgagcgggcagtggaggagaaggcctgcaactgtttg
ctgctcaaggtcaatcagatcggctcggtcacagaagccatccaagcgtgcaagctggcc
caggagaatggctggggggttatggtgagccatcgctctggagaaacggaggacacgttc
attgctgatcttgtcgtcggactgtgtacaggccagatcaagactggcgccccatgcaga
tctgaacgtctggcgaagtacaaccagctcatgagaattgaggaagagctgggggacgaa
gctcgcttcgcgggacataatttccgaaatcccagtgtgctgtga

DBGET integrated database retrieval system