KEGG   Mus musculus (house mouse): 13809
Entry
13809             CDS       T01002                                 
Symbol
Enpep, 6030431M22Rik, APA, Bp-1/6C3, Ly-51, Ly51
Name
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    13809 (Enpep)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13809 (Enpep)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13809 (Enpep)
   04090 CD molecules [BR:mmu04090]
    13809 (Enpep)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     13809 (Enpep)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M1
   13809 (Enpep)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13809 (Enpep)
CD molecules [BR:mmu04090]
 Proteins
  13809 (Enpep)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Aminopep DUF1570 DUF6479 DUF5022 DUF2613
Other DBs
NCBI-GeneID: 13809
NCBI-ProteinID: NP_031960
MGI: 106645
Ensembl: ENSMUSG00000028024
UniProt: P16406 Q52JJ6 Q8CD51 Q6P3C1
Position
3:complement(129062826..129126398)
AA seq 945 aa
MNFAEEEPSKKYCIKGKHVAIICGVVVAVGLIVGLSVGLTRSCEQDTTPAPSQPPPEAST
ALPPQDQNVCPDSEDESGEWKNFRLPDFINPVHYDLEVKALMEEDRYTGIVTISVNLSKP
TRDLWLHIRETKITKLPELRRPSGEQVPIRRCFEYKKQEYVVIQAAEDLAATSGDSVYRL
TMEFKGWLNGSLVGFYKTTYMEDGQIRSIAATDHEPTDARKSFPCFDEPNKKSTYSISII
HPKEYSALSNMPEEKSEMVDDNWKKTTFVKSVPMSTYLVCFAVHRFTAIERKSRSGKPLK
VYVQPNQKETAEYAANITQAVFDYFEDYFAMEYALPKLDKIAIPDFGTGAMENWGLVTYR
ETNLLYDPLLSASSNQQRVASVVAHELVHQWFGNTVTMDWWDDLWLNEGFASFFEFLGVN
HAEKDWQMLSQVLLEDVFPVQEDDSLMSSHPVVVTVSTPAEITSVFDGISYSKGASILRM
LQDWITPEKFQKGCQIYLKKFQFANAKTSDFWDSLQEASNLPVKEVMDTWTSQMGYPVVT
VSGRQNITQKRFLLDSKADPSQPPSELGYTWNIPVRWADNDNSRITVYNRLDKGGITLNA
NLSGDAFLKINPDHIGFYRVNYEGGTWDWIAEALSSNHTRFSAADRSSFIDDAFALARAQ
LLNYKIALNLTMYLKSEEDFLPWERVISSVSYIISMFEDDRELYPMIETYFQGQVKPVAD
LLGWQDTGSHITKLLRASILGFACKMGDREALGNASQLFDSWLKGSASIPVNLRLLVYRY
GMQNSGNEAAWNYTLEQYQKTSLAQEKEKLLYGLASVKDVKLLARYLEMLKDPNIIKTQD
VFTVIRYISYNSYGKTMAWNWIQLNWDYLVSRFTINDRYLGRIVTIAEPFNTELQLWQMQ
SFFAKYPNAGAGAKPREQVLETVKNNIEWLNVNRQSIREWFASLP
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgaactttgcagaggaagagccctccaagaaatactgcattaaaggcaaacacgtggcc
atcatctgtggagtagtggtggcagttggattaatagtgggactttctgtgggtttgacc
aggtcgtgtgagcaggacacaaccccagctccttcccaacctcctccggaagccagcact
gccctccctcctcaggaccagaatgtctgccctgacagtgaagatgaaagcggagaatgg
aaaaacttcaggctgcctgacttcatcaatccagttcactacgacctggaggtgaaggcc
ctgatggaggaagacaggtacacgggaatagtgaccatctctgtcaacttgagcaaaccc
actcgtgacctatggctccacatcagggagaccaagatcaccaagctgccggagctaagg
aggccctctggggagcaggtaccaattcgacggtgcttcgagtataagaagcaggagtac
gtggtgatccaggctgcagaagaccttgcggccaccagtggggacagtgtctatcggctg
accatggagtttaaaggctggctgaacggttcccttgtgggtttttacaaaaccacctac
atggaggacgggcaaatcaggagcatagctgccactgaccatgaaccaacagatgccagg
aagtccttcccttgtttcgacgaacccaacaagaagtcaacttacagtatatccatcatc
cacccaaaagaatactcagcactttctaatatgccagaagagaaatcagagatggtggat
gacaactggaagaaaaccacttttgtgaagtctgtcccaatgagcacttacctggtgtgc
tttgctgtgcatcggttcactgctatagagagaaaatccaggagcggcaaaccactcaag
gtctatgtccagcccaatcagaaggagacagcagagtatgcggcaaacataacccaagct
gtatttgattacttcgaagactacttcgctatggagtatgcgcttcctaaactggataaa
attgctattccagattttggcaccggcgccatggaaaattggggacttgtcacttaccga
gaaacaaacctgctttacgaccccctactatcggcctcatctaaccagcagagagtggcc
agcgtggttgcccacgaacttgtacaccagtggtttggaaatactgtgaccatggactgg
tgggacgacttgtggctaaatgaaggatttgcttcgttcttcgagttcttgggagtaaac
cacgcagaaaaagactggcagatgctcagtcaggtgctgcttgaagatgtgttccccgtg
caagaggacgactccctgatgtcttcacatccagtggtcgtcaccgtgtccacgccagct
gaaataacatctgtgtttgatgggatatcatacagcaagggagcttctattctgagaatg
ctccaagactggataacaccagagaaattccaaaaaggctgtcagatttacttgaaaaaa
ttccagttcgcgaatgcaaaaacttccgacttttgggattcactgcaagaggcaagcaat
ctgccagtgaaagaagtgatggacacctggactagccagatgggttatcctgtggtcact
gtgagtggaaggcagaacatcacccagaaacgctttctgttggactccaaagctgatcct
tcgcagccaccgtcagagctcggttacacatggaatattccagtcagatgggctgataat
gacaactcaaggatcaccgtgtacaataggttagacaaaggaggaatcactctgaatgct
aatcttagcggagatgcttttctcaaaatcaacccagatcacattgggttttatcgtgta
aattatgaaggaggaacgtgggattggatagccgaggctctctcctcaaaccacacgaga
ttctccgctgctgaccggtcaagttttattgatgatgcttttgctttggcaagagctcaa
cttctgaattataaaatagctctgaacttgaccatgtatctcaaatcagaagaggatttc
ctaccatgggagagagtcatttcatctgtaagctacatcattagcatgtttgaagatgac
agagagctgtaccccatgatagagacgtactttcaaggccaagtgaagcccgttgcagat
ttgctgggatggcaggataccggaagccacatcacaaagttactccgggcctctatctta
ggattcgcatgcaagatgggggacagagaagccttgggcaatgcttcccagttatttgac
tcctggctgaaagggagcgcaagtattccggtaaacctcaggctgcttgtgtaccgctat
ggaatgcagaactctggcaatgaggcagcgtggaactataccctagagcagtatcagaaa
acatcgcttgcccaagagaaagaaaaactgctctatgggttagcttcagtgaaggatgtt
aaactcttggcaaggtatctggaaatgctcaaagaccccaatattattaaaactcaggat
gtatttaccgtcatccgctacatctcctacaacagttatgggaagacaatggcctggaat
tggatacaactcaactgggactatctggtcagcagatttacaatcaatgacagatacctt
ggccggatcgtcaccatagctgagcccttcaacactgaactgcagctctggcagatgcag
agcttttttgcaaaatatccaaatgctggcgctggagcaaaacctagagagcaagtgctg
gagacggtgaagaacaacatcgagtggctaaacgtgaacagacagtccatcagagagtgg
ttcgctagcctgccgtag

DBGET integrated database retrieval system