KEGG   Mus musculus (mouse): 13819
Entry
13819             CDS       T01002                                 

Gene name
Epas1, HIF, HIF-2, HIF-2alpha, HIF2A, HL, HLF, HR, HRF, MO, MOP2, bHLHe7, bHLHe73
Definition
(RefSeq) endothelial PAS domain protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13819 (Epas1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    13819 (Epas1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13819 (Epas1)
   04131 Membrane trafficking [BR:mmu04131]
    13819 (Epas1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    13819 (Epas1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    13819 (Epas1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 Corona_I HLH
Other DBs
NCBI-GeneID: 13819
NCBI-ProteinID: NP_034267
MGI: 109169
Ensembl: ENSMUSG00000024140
UniProt: P97481
Structure
PDB: 

Position
17; 17 E4
AA seq 874 aa
MTADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLTLKNGSGFGKKSKDVSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGSKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRILELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDSSDDVAVTEKSNYLFTKLKEEPEELAQLAPTPGDAIISLDFGSQN
FDEPSAYGKAILPPGQPWVSGLRSHSAQSESGSLPAFTVPQADTPGNTTPSASSSSSCST
PSSPEDYYSSLENPLKIEVIEKLFAMDTEPRDPGSTQTDFSELDLETLAPYIPMDGEDFQ
LSPICPEEPLMPESPQPTPQHCFSTMTSIFQPLTPGATHGPFFLDKYPQQLESRKTESEH
WPMSSIFFDAGSKGSLSPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWPVGDQSAES
LGALPVGSSQLEPPSAPPHVSMFKMRSAKDFGARGPYMMSPAMIALSNKLKLKRQLEYEE
QAFQDTSGGDPPGTSSSHLMWKRMKSLMGGTCPLMPDKTISANMAPDEFTQKSMRGLGQP
LRHLPPPQPPSTRSSGENAKTGFPPQCYASQFQDYGPPGAQKVSGVASRLLGPSFEPYLL
PELTRYDCEVNVPVPGSSTLLQGRDLLRALDQAT
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgacagctgacaaggagaaaaaaaggagcagctcagagctgaggaaggagaaatcccgt
gatgccgcgaggtgccggcgcagcaaggagacggaggtcttctatgagttggctcatgag
ttgcccctgcctcacagtgtgagctcccacctggacaaagcctccatcatgcgcctggcc
atcagcttccttcggacacataagctcctgtcctcagtctgctctgaaaatgaatctgaa
gctgaggccgaccagcaaatggataacttgtacctgaaagccttggagggtttcattgct
gtggtgacccaagacggtgacatgatctttctgtcggaaaacatcagcaagttcatggga
cttactcaggtagaactaacaggacacagcatctttgacttcactcatccttgcgaccat
gaggagatccgtgagaacctgactctcaaaaacggctctggttttgggaagaagagcaaa
gacgtgtccaccgagcgtgacttcttcatgaggatgaagtgcacggtcaccaacagaggc
cggactgtcaacctcaagtcggccacctggaaggtcctgcactgcaccgggcaagtgaga
gtctacaacaactgcccccctcacagtagcctctgtggctccaaggagcccctgctgtcc
tgccttatcatcatgtgtgagccaatccagcacccatcccacatggacatccccctggac
agcaagactttcctgagccgccacagcatggacatgaagttcacctactgtgacgacaga
atcttggaactgattggttaccaccccgaggagctacttggacgctctgcctatgagttc
taccatgccctggattcggagaacatgaccaaaagtcaccagaacttgtgcaccaagggg
caggtggtatctggccagtaccggatgctagccaaacacggaggatatgtgtggctggag
acccaggggacggtcatctacaacccccgcaacctgcagcctcagtgtatcatgtgtgtc
aactatgtgctgagtgagatcgagaagaacgacgtggtgttctccatggaccagaccgaa
tccctgttcaagccacacctgatggccatgaacagcatctttgacagcagtgacgatgtg
gctgtaactgagaagagcaactacctgttcaccaaactgaaggaggagcccgaggaactg
gcccagttggcccccaccccaggagatgccattatttctctcgatttcggaagccagaac
ttcgatgaaccctcagcctatggcaaggccatccttcccccgggccagccatgggtctcg
gggctgaggagccacagtgcccagagcgagtccgggagcctgccagccttcactgtgccc
caggcagacaccccagggaacactacacccagtgcttcaagcagcagtagctgctccacg
cccagcagccctgaggactactattcatccttggagaatcccttgaagatcgaagtgatt
gagaagcttttcgccatggacacggagccgagggacccgggcagtacccagacggacttc
agtgaactggatttggagaccttggcaccctacatccctatggacggcgaggacttccag
ctgagccccatctgcccagaggagccgctcatgccagagagcccccagcccaccccccag
cactgcttcagtaccatgaccagcatcttccagccgctcaccccgggggccacccacggc
cccttcttcctcgataagtacccgcagcagttggaaagcaggaagacagagtctgagcac
tggcccatgtcttccatcttctttgatgctgggagcaaagggtccctgtctccatgctgt
ggccaggccagcacccctctctcttctatgggaggcagatccaacacgcagtggcccccg
gatccaccattacatttcggccctactaagtggcctgtgggtgatcagagtgctgaatcc
ctgggagccctgccggtggggtcatcgcagttggaacctccgagcgccccgcctcatgtc
tccatgttcaagatgaggtctgcaaaggacttcggggcccgaggtccatacatgatgagc
ccagccatgatcgccctgtccaacaagctgaagctaaagcggcagctggagtatgaggag
caagccttccaagacacaagcgggggggaccctccaggcaccagcagttcacacttgatg
tggaaacgtatgaagagcctcatgggcgggacctgtcctttgatgcctgacaagaccatc
agtgcgaacatggcccccgatgaattcacccaaaaatctatgagaggcctgggccagcca
ctgagacacctgccacctccccagccaccatctaccaggagctcaggggagaacgccaag
actgggttcccgccacagtgctatgcctcccagttccaggactacggtcctccaggagct
caaaaggtgtcaggcgtggccagtcgactgctggggccatcgttcgagccttacctgttg
ccggaactgaccagatatgactgtgaggtgaacgtgcccgtgcctggaagctccacactc
ctgcaggggagagaccttctcagagctctggaccaggccacctga

DBGET integrated database retrieval system