KEGG   Mus musculus (mouse): 13823Help
Entry
13823             CDS       T01002                                 

Gene name
Epb41l3, 4.1B, DAL1P, Dal1, Epb4.1l3, NBL3
Definition
(RefSeq) erythrocyte membrane protein band 4.1 like 3
  KO
K23961   
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 4_1_CTD SAB FERM_C FERM_N FERM_M FA
Motif
Other DBs
NCBI-GeneID: 13823
NCBI-ProteinID: NP_038841
MGI: 103008
Ensembl: ENSMUSG00000024044
Vega: OTTMUSG00000060066
UniProt: Q9WV92
Position
17 E1.3; 17 40.15 cM
AA seq 929 aa AA seqDB search
MTTESGSDSESKPDQEAEPQEAAGPQGQAGAQPGPEPAGGNGSLNGEKQQPALEQFPEAA
AHSTPVKREIGDKDRDFAAAAAKQLEYQQFEDDKLSQRSSSSKLSRSPLKIVKRPKSMQC
KVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIK
KQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYT
VQSELGDYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKK
LSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIR
PGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRT
QAQTRRASALIDRPAPYFERSSSKRYTMSRSLDGASVSENHEIYMKDSVSAAEVGTGQYA
TTKGISQTNLITTVTPEKKAEEERVEEEDRRKKAEEATPVTALRHEGKTDSERTDTAADG
ETSATESDQEEDAEIKAQDLDKTQDELMKHQTNISELKRTFLETSTETALTNEWEKRLST
SPVRLAARQEDAPMIEPLVPEETKQSSGEKLMDGSEILSLLESARKPTEFIGGVSSTTQS
WVQKLETKTEPVEAEVESTPHPQPLSTEKVLQETILVEERHVMSVHASGDASHTARDEVD
AAESTPTDRRHTGKGKEGSSVTEAAKEQRGEEVDQSAPEQEQPATVSHEEEQASTIRTSE
GLEQKSHFESSTVRVESTSVGSISPGGAKLEISTKEVPVVHTETKTITYESSQVDPGADL
EPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIK
EAKEQHPDMSVTKVVVHKETEITPEDGED
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaatcaggatcagactcagaatcgaagccagaccaggaggctgagccccag
gaggcagcagggcctcaggggcaagcaggggcacagcctggaccagagcctgcaggtgga
aacggcagcctcaacggagagaagcagcagccggccctagagcagttccctgaagccgct
gcacacagcaccccagtgaagagggagatcggtgacaaagaccgggactttgctgctgca
gctgcgaaacagcttgaatatcagcagtttgaggacgataagctctctcagagatcatcc
agcagcaaactctcacggtccccgctgaagatcgtgaaaaggcctaaaagcatgcagtgc
aaagtgacgcttctggatgggtcagagtacggctgcgatgtggacaagcgctcccgagga
caagtgctctttgacaaagtgtgcgaacatctgaacctgctagaaaaagactactttggc
ctcacgtatcgagacgcagagaatcagaagaactggttggaccctgctaaggaaattaaa
aagcagattcggagcggtgcttggcatttttcatttaatgtgaagttttacccaccagac
cctgcccagctatcagaagatatcaccaggtactacctctgcttgcagctgcgagatgat
attgtgtctggacggctaccctgttccttcgtgactcttgccctgctgggctcctacacg
gtgcagtcagagctcggggactacgatcccgatgaatgtgggaatgactacatcagtgag
ttccgctttgcgccaaaccacacgaaagaactggaggataaagtgattgagctgcacaag
agccacagaggaatgacgccagctgaagccgagatgcacttcctcgaaaatgccaaaaag
ctctccatgtacggggtggacttacaccatgccaaggattcggaaggagtggagattatg
ttaggagtctgtgccagtggtctgttgatatatcgtgaccggcttcgaataaacagattt
gcttggccgaaggtcttaaaaatttcttataaacggaacaacttttacattaaaatccgg
ccaggagagtttgagcaatttgaaagcaccattgggttcaagttgccaaaccatagggct
gccaagcgcctctggaaagtgtgtgtggagcatcatacatttttcagattattgctacca
gaagcacctccaaagaaattcttgaccttgggctccaagttccgctacagtggcagaacc
caggcgcaaacaagaagagccagtgcgttgatagaccgcccggccccttactttgaacgc
tcgtccagcaaacgatacaccatgtctcgcagcttggatggagcgtcagtgagtgaaaac
catgaaatatacatgaaggattctgtgtctgctgcagaggttggtacaggccagtacgcc
acaacaaagggcatctctcagaccaacttgatcaccactgtgactccagagaaaaaggct
gaagaggagcgcgtggaggaagaagacagaaggaagaaggctgaggaagccacacctgtc
acagccctccggcacgagggaaagactgacagtgaacggacagacactgcagctgatgga
gagaccagtgccacggagtcggaccaggaggaagatgcagagatcaaggcacaggatcta
gataaaactcaagatgagctgatgaagcaccaaaccaatattagtgagctgaaaagaacc
ttcttagaaacctctacagaaactgccttaacaaacgagtgggaaaagaggctctctaca
tctcccgtgcggctggcggccaggcaggaggatgcacccatgattgagccgctggtaccc
gaggagaccaaacagtcttctggggagaagctgatggatggctcggagatcctcagtctg
ttagagtctgcgcggaaacccacagagttcataggaggggtttcgtctactacccagagc
tgggtgcagaaactggaaacaaagactgagcctgtagaagcagaggtggaatccacgcca
caccctcagcccctcagcacggagaaggtgttgcaggaaacgatactggtagaggagagg
catgtgatgagtgtgcacgccagcggggatgcctcgcacacagccagggatgaagttgat
gctgcagaatccacacccacagatcgccgccacactgggaaagggaaggagggctcttct
gtgacagaagcagccaaggaacagagaggcgaggaggttgaccagtctgctcccgagcag
gaacagccagccactgtctcccatgaggaggagcaggcgtcgaccatccgcacttctgag
ggtttggaacaaaaatctcattttgagtcatccaccgtgagggtagaaagcacgagtgtg
ggcagtatttctccaggaggagcaaagctagagatctctaccaaggaggtgcccgtagtc
cacacggaaacgaaaaccatcacgtacgagtcatctcaggtcgatcctggggcagatctg
gagccaggtgtgctaatgagtgcccagacgatcacgtctgaaaccactagtactaccacc
accacacacatcaccaaaactgtgaaaggaggcatttcggagacgaggattgagaagcga
atagtcatcacaggggacgctgacattgaccatgaccaggcgctggctcaggcaattaaa
gaggccaaagagcagcacccagacatgtcagtgaccaaagtagtagtccataaagagaca
gaaatcacaccagaggacggagaggattga

DBGET integrated database retrieval system