KEGG   Mus musculus (house mouse): 13823
Entry
13823             CDS       T01002                                 
Symbol
Epb41l3, 4.1B, DAL1P, Dal1, Epb4.1l3, NBL3
Name
(RefSeq) erythrocyte membrane protein band 4.1 like 3
  KO
K23961  band 4.1-like protein 1/2/3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    13823 (Epb41l3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  FERM domain-containing proteins
   13823 (Epb41l3)
SSDB
Motif
Pfam: 4_1_CTD FERM_N FERM_C SAB FERM_M FA
Other DBs
NCBI-GeneID: 13823
NCBI-ProteinID: NP_038841
MGI: 103008
Ensembl: ENSMUSG00000024044
UniProt: Q9WV92
Position
17:69382642..69596986
AA seq 929 aa
MTTESGSDSESKPDQEAEPQEAAGPQGQAGAQPGPEPAGGNGSLNGEKQQPALEQFPEAA
AHSTPVKREIGDKDRDFAAAAAKQLEYQQFEDDKLSQRSSSSKLSRSPLKIVKRPKSMQC
KVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIK
KQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYT
VQSELGDYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKK
LSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIR
PGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRT
QAQTRRASALIDRPAPYFERSSSKRYTMSRSLDGASVSENHEIYMKDSVSAAEVGTGQYA
TTKGISQTNLITTVTPEKKAEEERVEEEDRRKKAEEATPVTALRHEGKTDSERTDTAADG
ETSATESDQEEDAEIKAQDLDKTQDELMKHQTNISELKRTFLETSTETALTNEWEKRLST
SPVRLAARQEDAPMIEPLVPEETKQSSGEKLMDGSEILSLLESARKPTEFIGGVSSTTQS
WVQKLETKTEPVEAEVESTPHPQPLSTEKVLQETILVEERHVMSVHASGDASHTARDEVD
AAESTPTDRRHTGKGKEGSSVTEAAKEQRGEEVDQSAPEQEQPATVSHEEEQASTIRTSE
GLEQKSHFESSTVRVESTSVGSISPGGAKLEISTKEVPVVHTETKTITYESSQVDPGADL
EPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIK
EAKEQHPDMSVTKVVVHKETEITPEDGED
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgacgaccgaatcaggatcagactcagaatcgaagccagaccaggaggctgagccccag
gaggcagcagggcctcaggggcaagcaggggcacagcctggaccagagcctgcaggtgga
aacggcagcctcaacggagagaagcagcagccggccctagagcagttccctgaagccgct
gcacacagcaccccagtgaagagggagatcggtgacaaagaccgggactttgctgctgca
gctgcgaaacagcttgaatatcagcagtttgaggacgataagctctctcagagatcatcc
agcagcaaactctcacggtccccgctgaagatcgtgaaaaggcctaaaagcatgcagtgc
aaagtgacgcttctggatgggtcagagtacggctgcgatgtggacaagcgctcccgagga
caagtgctctttgacaaagtgtgcgaacatctgaacctgctagaaaaagactactttggc
ctcacgtatcgagacgcagagaatcagaagaactggttggaccctgctaaggaaattaaa
aagcagattcggagcggtgcttggcatttttcatttaatgtgaagttttacccaccagac
cctgcccagctatcagaagatatcaccaggtactacctctgcttgcagctgcgagatgat
attgtgtctggacggctaccctgttccttcgtgactcttgccctgctgggctcctacacg
gtgcagtcagagctcggggactacgatcccgatgaatgtgggaatgactacatcagtgag
ttccgctttgcgccaaaccacacgaaagaactggaggataaagtgattgagctgcacaag
agccacagaggaatgacgccagctgaagccgagatgcacttcctcgaaaatgccaaaaag
ctctccatgtacggggtggacttacaccatgccaaggattcggaaggagtggagattatg
ttaggagtctgtgccagtggtctgttgatatatcgtgaccggcttcgaataaacagattt
gcttggccgaaggtcttaaaaatttcttataaacggaacaacttttacattaaaatccgg
ccaggagagtttgagcaatttgaaagcaccattgggttcaagttgccaaaccatagggct
gccaagcgcctctggaaagtgtgtgtggagcatcatacatttttcagattattgctacca
gaagcacctccaaagaaattcttgaccttgggctccaagttccgctacagtggcagaacc
caggcgcaaacaagaagagccagtgcgttgatagaccgcccggccccttactttgaacgc
tcgtccagcaaacgatacaccatgtctcgcagcttggatggagcgtcagtgagtgaaaac
catgaaatatacatgaaggattctgtgtctgctgcagaggttggtacaggccagtacgcc
acaacaaagggcatctctcagaccaacttgatcaccactgtgactccagagaaaaaggct
gaagaggagcgcgtggaggaagaagacagaaggaagaaggctgaggaagccacacctgtc
acagccctccggcacgagggaaagactgacagtgaacggacagacactgcagctgatgga
gagaccagtgccacggagtcggaccaggaggaagatgcagagatcaaggcacaggatcta
gataaaactcaagatgagctgatgaagcaccaaaccaatattagtgagctgaaaagaacc
ttcttagaaacctctacagaaactgccttaacaaacgagtgggaaaagaggctctctaca
tctcccgtgcggctggcggccaggcaggaggatgcacccatgattgagccgctggtaccc
gaggagaccaaacagtcttctggggagaagctgatggatggctcggagatcctcagtctg
ttagagtctgcgcggaaacccacagagttcataggaggggtttcgtctactacccagagc
tgggtgcagaaactggaaacaaagactgagcctgtagaagcagaggtggaatccacgcca
caccctcagcccctcagcacggagaaggtgttgcaggaaacgatactggtagaggagagg
catgtgatgagtgtgcacgccagcggggatgcctcgcacacagccagggatgaagttgat
gctgcagaatccacacccacagatcgccgccacactgggaaagggaaggagggctcttct
gtgacagaagcagccaaggaacagagaggcgaggaggttgaccagtctgctcccgagcag
gaacagccagccactgtctcccatgaggaggagcaggcgtcgaccatccgcacttctgag
ggtttggaacaaaaatctcattttgagtcatccaccgtgagggtagaaagcacgagtgtg
ggcagtatttctccaggaggagcaaagctagagatctctaccaaggaggtgcccgtagtc
cacacggaaacgaaaaccatcacgtacgagtcatctcaggtcgatcctggggcagatctg
gagccaggtgtgctaatgagtgcccagacgatcacgtctgaaaccactagtactaccacc
accacacacatcaccaaaactgtgaaaggaggcatttcggagacgaggattgagaagcga
atagtcatcacaggggacgctgacattgaccatgaccaggcgctggctcaggcaattaaa
gaggccaaagagcagcacccagacatgtcagtgaccaaagtagtagtccataaagagaca
gaaatcacaccagaggacggagaggattga

DBGET integrated database retrieval system