KEGG   Mus musculus (house mouse): 13824
Entry
13824             CDS       T01002                                 
Symbol
Epb41l4a, Epb4.1l4, Epb4.1l4a, NBL4
Name
(RefSeq) erythrocyte membrane protein band 4.1 like 4a
  KO
K23962  band 4.1-like protein 4A
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    13824 (Epb41l4a)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  FERM domain-containing proteins
   13824 (Epb41l4a)
SSDB
Motif
Pfam: FERM_N FERM_M FERM_C FA
Other DBs
NCBI-GeneID: 13824
NCBI-ProteinID: NP_038540
MGI: 103007
Ensembl: ENSMUSG00000024376
UniProt: P52963 Q3USC8
Position
18:complement(33929380..34143678)
AA seq 686 aa
MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFRHINLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDALQGRLPCPVNIAAQMGAYAIQAELGDHDPYKHTAGYVSEYRFVPDQKEELEEAIERI
HKTLMGQAPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPSGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPDT
ESNSLSRKLSKFGSISYKHRYSGRTALQMSRDLSIQLPRPNQNVVRSRSKTYPKRVAQTQ
PTGSNNINRITANTENGENEGTTKIIAPSPVKSFKKAKNENSPDPQRSKSHAPWEENGPQ
SGLYNSSSDRTKSPKFPCARQRNLSCGSDNDSSQLMRRRKAHNSGEDSDLKQRRRSRSRC
NTSSGSESENSNREHRKKRNRTRQENDMVDSGPQWEAVLRRQKEKNQADPNNRRSRHRSR
SRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKVETQGDPVRIRHSHSPRSYRQY
RRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGGSTVHQRRNGSKDSLIEEKSQL
STINPAGKPTAKTIKTIQAARLKAET
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgggctgtttctgcgccgttccggaagaattttactgcgaagttttgctcctggacgag
tccaagctcaccctcaccacccagcagcagggcatcaagaagtcaacaaaaggctctgtt
gtccttgaccacgttttccgtcacataaacctcgtggagatagattattttgggctgcgg
tactgtgacagaagccatcagacatattggctggatcccgcaaaaacccttgcagaacac
aaggagctgatcaacactggacctccatatactttgtattttggtattaaattctatgct
gaagatccatgtaaactcaaagaagaaataaccagatatcagtttttcttacaggtgaag
caagatgcccttcagggccggctgccttgccctgtcaatattgctgctcagatgggggca
tatgccatccaggccgaactgggagaccacgacccatacaagcacactgcggggtatgtg
tcggagtaccggtttgttcctgatcagaaggaagagctggaagaagccatagaaaggatt
cataaaactctaatgggtcaggctccttccgaagctgagctgaattacttgaggactgcc
aaatccctggagatgtatggtgttgacctccatcctgtctatggagaaaataagtccgag
tacttcttaggcttgactccatcgggagttgtcgtctataagaataaaaagcaagtgggg
aagtatttctggcctcggattacaaaggtgcacttcaaggaaacccagtttgagctcaga
gtcttgggaaaagactgtaatgaaacctcattcttttttgaagctcgaagcaaaactgct
tgcaagcacctctggaaatgcagcgtagagcaccatacgtttttcagaatgccggacaca
gaatcaaattcattatcaagaaaactcagcaagtttgggtccataagttataaacatcgg
tacagtggcaggacagctttgcaaatgagccgagatctttctatccaacttccccggccc
aatcagaacgtggtgagaagtcgaagcaagacttaccccaagagggtagcacagactcag
cccactggatcaaacaacatcaatcggataactgcaaacacggaaaacggggagaatgaa
ggaaccaccaagatcattgcgccttccccagtgaaaagttttaagaaagcaaagaatgaa
aacagccctgacccccaaagaagcaaatctcatgcaccttgggaagaaaacggaccgcag
agcggactatacaactcctccagtgaccgcactaagtcaccaaagtttccctgtgcccgg
cagcgcaacctctcctgcggcagtgacaatgactcctcgcaactgatgaggcgaaggaaa
gctcacaacagtggcgaagactcagatctcaagcagaggaggaggtcacgctcacgctgt
aacacaagcagtggtagtgagtcagaaaattctaacagagaacaccggaaaaagagaaac
agaacccgccaggagaatgacatggttgactcggggcctcagtgggaagccgtgttaagg
agacagaaggaaaagaaccaagcggaccctaacaaccggagatccagacacagatctcgc
tcaagaagtcctgacatccaagcaaaagaagaactgtggaagcacatccagaaggagctt
gtggacccatctggactgtcagaagagcagctgaaggagatcccgtacactaaagtagag
actcagggtgacccggtccgcatccggcattctcattccccgcggagttaccggcagtac
cgaagatcccagtgttcagacggagaacgatccgttctctcggaagtgaactcaaagaca
gatcttgtaccaccacttccggtcacccgttcctcagatgctcaggggtctggaggctcg
acagttcatcagaggagaaatgggtctaaagacagcttgattgaagaaaagtctcagcta
tctacaatcaacccggctgggaaacctacagcaaaaaccataaaaaccatccaggctgct
cgcctcaaggcagagacttga

DBGET integrated database retrieval system