KEGG   Mus musculus (mouse): 13835
Entry
13835             CDS       T01002                                 

Symbol
Epha1, 5730453L17Rik, AL033318, Eph, Esk
Name
(RefSeq) Eph receptor A1
  KO
K05102  Eph receptor A1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13835 (Epha1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13835 (Epha1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13835 (Epha1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   13835 (Epha1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Ephrin_rec_like ABC1 Adeno_E3_CR2 Tissue_fac Haspin_kinase Nitrate_red_gam
Other DBs
NCBI-GeneID: 13835
NCBI-ProteinID: NP_076069
MGI: 107381
Ensembl: ENSMUSG00000029859
Vega: OTTMUSG00000057494
UniProt: Q60750
Structure
PDB: 
1X5A

Position
6; 6 B2.1
AA seq 977 aa
MERRWPLGLALLLLLLCAPLPPGARAEEVTLMDTSTAQGELGWLLDPPETGWSEVQQMLN
GTPLYMYQDCPIQEGGDTDHWLRSNWIYRGEEASRIYVELQFTVRDCKSFPGGAGPLGCK
ETFNLFYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLASGSVKLNVERCSLGHLTRR
GLYLAFHNPGSCVALVSVRVFYQRCAETVHGLAHFPDTLPGPGGLVEVAGTCLSHAQISL
GSSGTPRMHCSPDGEWLVPVGQCQCEPGYEESSGNVGCTACPTGFYRVDMNTLRCLKCPQ
HSIAESEGSTICTCENGHYRAPGEGPQVACTRPPSAPQNLSFSTSGTQLSLRWEPPRDTG
GRHDIRYSVECLQCRGIAQDGGPCQPCGKGVHFSPAASGLTTSTVQVQGLEPYANYTFTV
KSQNRVSGLDSSSPSSASLSINMGHAESLSGLSLKLVKKEPRQLELTWAGSRPRNPGGNL
SYELHVLNQDEEWHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSPPV
SRSLTGGEIVAVIFGLLLGIALLIGIYVFRSRRGQRQRQQRQRERTTNVDREDKLWLKPY
VDLQAYEDPAQGALDFAQELDPAWLIVDTVIGEGEFGEVYRGALRLPSQDCKTVAIKTLK
DTSPDGYWWNFLREATIMGQFNHPHILRLEGVITKRKPIMIITEFMENGALDAFLKERED
QLAPGQLVAMLLGIASGMNCLSGHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDG
TYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSI
EDGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFLQLQAHLEQLLTDPHSLRTIANFDPR
VTLRLPSLSGSDGIPYRSVSEWLESIRMKRYILHFRSAGLDTMECVLELTAEDLTQMGIT
LPGHQKRILCSIQGFKD
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggagcggcgctggcccctggggcttgcattgctgctgctgctgctctgcgccccgctg
cccccgggggcgcgcgccgaggaagtcactctaatggacacaagcacagcacaaggagag
ctgggctggcttctggatcccccagagactgggtggagtgaggtgcaacaaatgctaaac
gggacacccctgtacatgtaccaagactgcccaatacaggaaggtggggacactgaccac
tggcttcgctccaattggatctaccgcggagaggaagcttcacgcatctacgtggagctg
cagttcaccgtgcgggactgtaagagtttcccagggggagctgggcctctgggatgcaaa
gagaccttcaaccttttctacatggagagtgaccaggatgtgggcattcagctccgacga
cctttgttccaaaaggtaacaactgtggcagcagaccagagcttcaccatcagagacctg
gcatctggctctgtaaagctgaatgtagaacgctgctcgttgggccacctcacccgccgt
ggcctctacttagctttccacaacccgggttcctgtgtggcgctagtgtctgtaagggtg
ttctaccagcgctgtgccgagaccgtgcatggcttggcccacttccctgacactctccct
ggacctggagggttggttgaagtagctggaacgtgcctctcccatgcacagatcagcttg
gggtcctcaggtacaccacgaatgcactgcagccctgatggcgagtggctggtgcctgtg
ggtcagtgccagtgcgagcctggctatgaagaaagcagtggaaatgtgggatgcactgcc
tgtcctactggtttctatcgagtggacatgaatacactccgttgtctcaagtgcccccaa
catagcatagcagagtctgaggggtctaccatctgtacctgtgagaatggacattatcga
gcccctggggagggtccccaggtagcatgcacacgtcccccatcggctccccaaaatctg
agcttctccacatcagggactcaactctccctgcgctgggagccccccagagatacaggg
ggacgccatgatatcagatacagcgtggagtgcttgcagtgtcggggcattgcacaggat
gggggtccctgccaaccctgtggaaaaggtgtgcacttttccccggctgcttccgggctc
accacatctaccgtgcaagtgcaaggcctcgagccttacgccaactacacatttaccgtc
aaatcccaaaacagagtgtcaggactggacagttccagccctagcagcgcctccctcagt
atcaacatggggcacgcagagtcactctctggcctgtcactgaagctggtgaagaaagaa
ccgaggcagctggagctgacttgggcagggtcccgaccccgaaatcctggagggaatctg
agctatgagctgcacgtgctgaatcaggacgaagaatggcaccagatggtgttggaaccc
agggtcttgctgacaaaacttcagccagataccacatacattgtcagagtgcgaacactg
accccactggggcctggccctttctcccctgaccatgagtttcggacaagcccaccagtt
tccagaagcctgaccggaggagagattgtggccgtcatctttggattgctgcttggaata
gctctgctgatcgggatttatgtcttccgttcaaggagaggccagagacagagacagcag
aggcagcgtgaacgcaccaccaatgtcgatcgagaggacaagctgtggctaaaaccctat
gtggacctccaggcctatgaggaccctgcacagggagccttagactttgcccaggaactg
gacccagcctggctgattgtggacactgtcataggagaaggggagtttggtgaagtgtat
cggggagccctgagactccccagccaagattgcaagactgtggccattaagaccttgaaa
gatacatccccagatggctactggtggaatttccttcgagaggcaactatcatgggccag
ttcaaccacccacacattctacgcctagaaggtgtcatcacaaaaagaaagcccatcatg
atcatcacagaatttatggaaaatggagccctggatgcctttctgaaggaacgggaggac
caactagctcctggtcagctagtggctatgctactgggcatagcatcaggcatgaactgc
ctcagtggccacaattatgtccatagagacctggctgccaggaacatcttggtgaatcag
aacctgtgctgcaaggtgtctgactttggcttgacccgcctcctggatgactttgacggc
acctatgaaacccagggaggaaagatccccatccgatggacagccccagaagctattgcc
catcggatcttcaccacagccagtgatgtgtggagctttgggattgtaatgtgggaggtg
ttgagttttggcgacaaaccctatggggagatgagcaaccaagaggtaatgaaaagcatt
gaagatgggtaccggttgccccctcctgtggactgtcctgcccctctctatgaactcatg
aagaactgctgggcttacgatcgtgcccgtcgaccccacttcctccagctgcaggcacat
ctggaacagttgcttactgacccccattccctaaggacaattgccaactttgaccctagg
gtgaccttacgcctgcccagcctgagtggctctgatgggatcccttatcgaagtgtctct
gagtggcttgaatccatacgcatgaagcgctacatcctgcacttccgttcggctgggctg
gacaccatggagtgtgtgctggagctgacggctgaggacctgacgcagatgggaataacg
ttgccagggcaccagaaacgaattctctgcagtattcaaggatttaaggactga

DBGET integrated database retrieval system