KEGG   Mus musculus (mouse): 13836Help
Entry
13836             CDS       T01002                                 

Gene name
Epha2, AW545284, Eck, Myk2, Sek-2, Sek2
Definition
(RefSeq) Eph receptor A2
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    13836 (Epha2)
   04015 Rap1 signaling pathway
    13836 (Epha2)
   04010 MAPK signaling pathway
    13836 (Epha2)
   04151 PI3K-Akt signaling pathway
    13836 (Epha2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13836 (Epha2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13836 (Epha2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13836 (Epha2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   13836 (Epha2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Pur_ac_phosph_N Interfer-bind DUF2369 Ephrin_rec_like Haspin_kinase SAM_KSR1 SKG6
Motif
Other DBs
NCBI-GeneID: 13836
NCBI-ProteinID: NP_034269
MGI: 95278
Ensembl: ENSMUSG00000006445
Vega: OTTMUSG00000010200
UniProt: Q03145
Structure
PDB: 

Position
4 D3; 4 73.67 cM
AA seq 977 aa AA seqDB search
MELRAVGFCLALLWGCALAAAAAQGKEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDD
MPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNL
YYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLA
FQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYG
GEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLP
STEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQD
IVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVS
GLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDA
NSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSANMAVIG
GVAVGVVLLLVLAGVGLFIHRRRRNLRARQSSEDVRFSKSEQLKPLKTYVDPHTYEDPNQ
AVLKFTTEIHPSCVARQKVIGAGEFGEVYKGTLKASSGKKEIPVAIKTLKAGYTEKQRVD
FLSEASIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGM
LRGIASGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKI
PIRWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTP
MDCPSAIYQLMMQCWQQERSRRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTS
GSEGVPFRTVSEWLESIKMQQYTEHFMVAGYTAIEKVVQMSNEDIKRIGVRLPGHQKRIA
YSLLGLKDQVNTVGIPI
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgggcagtcggtttctgcctggcgctgctgtggggttgcgcgctggcggcc
gcggcggcacagggaaaggaagttgttttgttggacttcgcagcaatgaagggagagctc
ggctggctcacgcacccctatggcaaagggtgggacctgatgcagaacatcatggacgac
atgcctatctacatgtactcggtgtgcaacgtggtatccggcgaccaggacaactggctc
cgcaccaactgggtgtaccgggaggaggccgagcgcatctttattgagctcaagttcacg
gtgcgagactgtaacagcttcccgggtggcgccagctcatgcaaagagaccttcaacctc
tactatgcagagtcagatgtggactatggcaccaacttccagaagcgccagttcaccaag
attgacaccatcgcccctgacgagatcacggtcagcagtgacttcgaggctcgcaatgtc
aagctgaacgtagaggagcgcatggtggggccccttacccggaagggcttctacctggcc
ttccaggacatcggcgcctgcgtggcgctgctctccgttcgcgtctactacaagaagtgt
cccgagatgctgcagagcttggctcgcttccccgagaccattgctgtcgctgtctccgat
acacaacccctggccacggtggccggtacctgcgtggaccatgccgtggtgccttatggg
ggcgaggggcctctcatgcactgcacggtggatggcgagtggctggtgcccatcgggcag
tgcctgtgccaggaaggctacgagaaggtcgaggatgcctgccgagcctgttctccagga
ttcttcaagtctgaggcatctgagagcccttgcctggagtgtccagagcataccctgcca
tccacagagggtgccacctcctgccagtgtgaagaaggctatttcagggcacctgaggac
ccactgtccatgtcttgcacacgtccaccctctgcccccaactacctcacggccattggc
atgggtgccaaagtagaactgcgttggacagctcccaaggacactggtggccgccaggac
attgtctacagtgtcacttgcgaacagtgctggccagagtctggcgagtgtgggccctgt
gaggcgagcgtgcgctattcagaacctcctcacgccctgacccgcacgagtgtgacagtc
agtgacctggagccccacatgaactataccttcgctgtcgaagcacgcaatggtgtctca
ggcctggtgactagccgaagcttccggactgccagcgtcagtattaaccaaacagagccc
cccaaagtgaggctggaggaccgaagcaccacctccctgagtgtcacctggagcatcccg
gtgtcacagcagagccgtgtgtggaagtacgaagtcacctaccgcaagaagggggatgcc
aacagctataatgtgcgccgcacggaaggcttctccgtgaccctggatgaccttgctccg
gataccacgtacctggtgcaggtgcaggcgctgacgcaggagggccagggagccggcagc
aaagtgcacgagttccagacactgtccacggaaggatctgccaacatggcggtgatcggc
ggtgtggctgtaggtgttgttttgcttctggtactggcaggagttggcctcttcatccat
cgaaggaggaggaacctgcgggctcgccagtcctctgaggatgtccgtttttccaagtca
gaacaactaaagcccctgaagacctatgtggatcctcacacttacgaagaccccaaccag
gctgtactcaagtttaccaccgagatccacccatcctgtgtggcaaggcagaaggtcatt
ggagcaggagagtttggagaggtctataaagggacgctgaaggcatcctcggggaagaag
gagataccggtggccatcaagacactgaaagcgggctacactgagaagcagcgggtggac
ttcctgagcgaggccagcatcatgggccagtttagccaccacaatatcatccgcctggag
ggcgtggtctctaaatacaaacccatgatgattatcacagagtacatggagaatggagcg
ctagacaagttccttagggagaaggatggtgagttcagtgtacttcagttggtgggcatg
ctgaggggtatcgcatccggcatgaagtacctggccaacatgaactacgtgcaccgggac
ctggccgcccgcaacatcctcgtcaacagcaacctggtgtgcaaggtgtccgattttggc
ctgtcgcgtgtgctggaagatgaccccgaggccacctacaccacaagtggcggcaagatc
cctattcgatggacagccccagaggccatttcctaccgcaagttcacctcagccagcgat
gtgtggagctacggcattgtcatgtgggaagtgatgacttatggcgaacggccctactgg
gaactgtcaaaccacgaggtcatgaaagccatcaacgacggcttccggctccctacgccc
atggactgcccttcagccatttaccagctcatgatgcagtgctggcagcaagagcgctcc
cgccgacccaagtttgccgacatcgttagcatcctggacaagctcatccgagcccccgac
tccctcaagacgctggctgactttgatccccgagtgtccatccggctgcccagcaccagc
ggctcggagggagtccccttccgtacggtgtccgagtggctggagagcatcaagatgcaa
cagtacacggaacacttcatggtggctggctacacggccatcgagaaggtggtacagatg
tccaacgaagacatcaaaaggatcggagtgcgtcttcctggccaccagaagcgtattgcc
tacagcctgctgggactcaaggaccaggtcaacacagtggggattcctatctga

DBGET integrated database retrieval system