KEGG   Mus musculus (mouse): 13844Help
Entry
13844             CDS       T01002                                 

Gene name
Ephb2, Cek5, Drt, ETECK, Erk, Hek5, Nuk, Prkm5, Qek5, Sek3, Tyro5
Definition
(RefSeq) Eph receptor B2
  KO
K05111  Eph receptor B2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13844 (Ephb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13844 (Ephb2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13844 (Ephb2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   13844 (Ephb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N SusE cEGF Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 13844
NCBI-ProteinID: NP_034272
MGI: 99611
Ensembl: ENSMUSG00000028664
Vega: OTTMUSG00000009767
UniProt: P54763
Structure
PDB: 

Position
4 D3; 4 69.0 cM
AA seq 986 aa AA seqDB search
MAVRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQ
VCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADF
DLATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQD
YGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLY
CNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGA
TNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNI
ICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSE
YNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIKEK
LPLIVGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPF
TYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYT
EKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTV
IQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTY
TSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI
NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTL
AGHQKKILNSIQVMRAQMNQIQSVEV
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcgcaggctgggggccgcgctgctgctgctgccgctgctagccgccgtggaa
gaaaccctgatggactctacgacagcaacggctgagctgggctggatggtacatccccca
tcagggtgggaagaggtgagcggctacgacgagaacatgaacactatccgtacctaccag
gtgtgcaatgtctttgagtcaagccagaacaactggctgcggaccaaattcatccggcgc
cgcggcgcccaccgcatccacgtggagatgaagttctcggtgcgtgactgcagcagcatt
cccagcgtgccgggctcctgcaaggagaccttcaacctctactactatgaggctgatttt
gacttagccaccaaaacctttcccaactggatggagaatccgtgggtgaaggtggacacc
atcgcggccgatgagagcttctctcaggtggacctgggtggccgcgtcatgaaaatcaac
actgaggtgcgaagcttcggtcccgtgtcccgcaatggtttctacctggccttccaggac
tatggcggctgtatgtccctcattgctgtgcgcgtcttctaccggaagtgcccccgaatc
atccagaatggtgccatcttccaggagacactgtcgggggctgagagcacttcgctggtg
gcagctcggggcagctgcatcgccaatgctgaagaagtggatgtgcccatcaaactctac
tgtaacggggacggcgaatggctggtgcccataggtcgctgcatgtgcaaggcgggcttc
gaggctgtggagaacggcaccgtctgccgaggttgtccatcaggaaccttcaaggccaac
caaggggacgaagcctgcacccactgtcccatcaacagccgcaccacctccgagggtgcc
accaactgtgtatgccgcaacggctactacagggccgacctggaccccttagacatgcct
tgcacaaccatcccctctgcgccccaggctgtgatctccagcgtcaacgagacgtccctc
atgctagagtggaccccaccccgagactcggggggtcgcgaggatcttgtttacaacatc
atctgcaagagctgtggctccggccggggcgcatgcacgcgctgcggggacaacgtgcag
tacgcgccccgccagctgggcctgactgagccgcgcatctacatcagtgacctgctggca
cacacgcagtacaccttcgagatccaggccgtgaacggtgtgactgaccagagtcccttc
tcacctcagttcgcctctgtgaacatcaccaccaaccaagcagcaccatcggccgtgtcc
atcatgcaccaggtgagccgcactgtggacagcatcaccctgtcgtggtcccagccagac
cagcccaacggtgtgatcctggactacgagctgcagtactatgagaaggagctcagtgag
tacaacgccacggccataaaaagccccaccaacacagtcactgtgcagggcctcaaagcc
ggcgccatctatgtcttccaggtgcgggcacgcaccgttgcaggctatgggcgctacagt
ggcaagatgtacttccaaaccatgacagaagccgagtaccagaccagcatcaaggaaaag
ctacccctcatcgttggctcctccgccgccggcttagtcttcctcatcgctgtggtcgtc
attgccatcgtatgtaacagacgggggtttgagcgtgccgactcagagtacacggacaag
ctacaacactacaccagcggacacatgaccccaggcatgaagatctatatagaccctttc
acctatgaagatcctaatgaggcagtgcgggagtttgccaaggaaattgacatctcctgt
gtcaagattgagcaggtgatcggagcaggggaatttggtgaggtctgcagtggccatttg
aagctgccaggcaagagagagatctttgtagccatcaagaccctcaagtcaggatacacg
gagaaacagcgccgggacttcctgagtgaggcatccatcatgggccagttcgaccacccc
aatgtcatccatctggaaggggttgtcaccaagagcacacctgtcatgatcatcactgaa
ttcatggagaacggatctctggactccttcctccggcaaaacgatgggcagttcacagtc
atccaactggtgggcatgctgaggggcattgcagccggcatgaagtacctggcggacatg
aactacgtgcaccgtgaccttgctgctcgaaacatcctcgtcaacagcaacctggtgtgt
aaggtgtctgattttgggctctcacgcttcctggaggatgacacgtctgaccccacctat
accagcgctctgggtgggaagatccccatccgttggacggcaccggaagccatccagtac
cggaaattcacctcggccagtgatgtgtggagctatggcatcgtcatgtgggaggtgatg
tcctacggggaacgaccctactgggacatgaccaatcaagacgtaatcaacgccattgaa
caggactacagactacctccgcccatggactgccctagtgccctgcaccagctcatgctg
gactgctggcagaaggaccgcaaccaccggcccaagttcggccagattgtcaacacgctg
gacaagatgatccgaaaccccaacagcctcaaagccatggcacccctgtcctctggcatc
aacctgccactgctggaccgcacgataccggactacaccagctttaacacggtggatgag
tggctagaggccatcaagatgggccagtacaaggagagctttgccaacgccggctttacc
tctttcgacgttgtatctcagatgatgatggaggacattctccgcgttggggtcactcta
gctggccaccagaaaaaaatcctgaacagtatccaggtgatgcgggcccagatgaaccag
atccagtctgtagaggtttga

DBGET integrated database retrieval system