KEGG   Mus musculus (mouse): 13846
Entry
13846             CDS       T01002                                 

Gene name
Ephb4, AI042935, Htk, MDK2, Myk1, Tyro, Tyro11, b2b2412C, b2b2412Clo
Definition
(RefSeq) Eph receptor B4
  KO
K05113  Eph receptor B4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13846 (Ephb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13846 (Ephb4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13846 (Ephb4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   13846 (Ephb4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N KdpC PRIMA1
Other DBs
NCBI-GeneID: 13846
NCBI-ProteinID: NP_034274
MGI: 104757
Ensembl: ENSMUSG00000029710
Vega: OTTMUSG00000021937
UniProt: P54761 Q3V1K8 Q8C7S3
Position
5; 5 G2
AA seq 987 aa
MELRALLCWASLATALEETLLNTKLETADLKWVTYPQAEGQWEELSGLDEEQHSVRTYEV
CDMKRPGGQAHWLRTGWVPRRGAVHVYATIRFTMMECLSLPRASRSCKETFTVFYYESEA
DTATAHTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNIKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCSWLITNLTYFPETVPRELVVPVAGSCVANAVPTANPSPSLYCR
EDGQWAEQQVTGCSCAPGYEAAESNKVCRACGQGTFKPQIGDESCLPCPANSHSNNIGSP
VCLCRIGYYRARSDPRSSPCTTPPSAPRSVVHHLNGSTLRLEWSAPLESGGREDLTYAVR
CRECRPGGSCLPCGGDMTFDPGPRDLVEPWVAIRGLRPDVTYTFEVAALNGVSTLATGPP
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLILSWAIPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESESWREQLAL
IAGTAVVGVVLVLVVVIIAVLCLRKQSNGREVEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSVPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFEVVSQISAEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGAPGGTGGPAQQF
NT seq 2964 nt   +upstreamnt  +downstreamnt
atggagctccgagcgctgctgtgctgggcttccctcgccactgctttagaagagaccctg
ttgaacacaaaactggaaacggcggatctgaaatgggtgacttaccctcaggcagagggc
cagtgggaggagctaagcggcctggatgaggaacagcacagcgtccgcacctatgaggtg
tgcgacatgaagcgtccagggggccaggctcactggctgcgcactggctgggtcccaagg
cgaggtgctgtccacgtgtatgccacgatacgcttcaccatgatggaatgcctgtccctg
ccgagggccagtcgctcctgcaaggagacattcactgtcttctattacgagagcgaagct
gatacggccacggcccatacgcccgcctggatggagaacccctacatcaaggtggacaca
gtggccgcagaacatctgactcggaagcgccctggagctgaagccacagggaaagttaat
atcaagacgctgcgcctgggtcctctcagcaaagctggcttctacctggctttccaggac
caaggagcctgcatggctctgctctccctgcatctcttttacaagaagtgctcctggctg
atcacgaacttgacctacttccccgagacggtgcctcgggagctcgtggtgccggtggca
ggtagctgcgtggccaacgcggtccctaccgccaaccccagccccagcctctactgccgg
gaagatggtcaatgggctgagcagcaggtcacgggctgcagctgcgcgccagggtacgag
gctgcggaaagcaacaaagtatgcagagcctgtggccagggaaccttcaagccccaaata
ggagacgagtcctgcctgccatgcccagccaacagccactcgaataacattgggtctcct
gtctgcctgtgtcgaattgggtattaccgggcccgctcagacccccggagttcaccttgc
actaccccaccctctgctccaagaagcgtggttcaccatttgaatggttccaccctgcgc
ctggaatggagtgctccccttgagtccggaggccgagaggacctcacttatgctgtacgc
tgccgagagtgccgtcctgggggttcctgcttgccctgtgggggcgacatgaccttcgac
cccggtcctcgagacctggttgagccctgggtggcaatccgagggctgcgtcctgatgtc
acctatacctttgaggttgctgctttgaatggtgtgtctaccttagccactggaccacct
ccttttgagcctgtcaatgtcaccactgaccgtgaggtgcctcctgcagtgtctgacatc
cgagtgactcggtcgtcacccagcagcttgatcctgtcatgggctatccccagagcaccc
agtggggccgtgctggactacgaggtcaagtatcatgagaagggcgcagagggccccagc
agtgttcgtttcctgaagacatcagaaaaccgagctgagctccgggggctgaagcgggga
gccagctatctggtccaggtacgcgcacggtccgaggctggctacggtcccttcggccag
gagcatcacagtcagactcaactggatgagagcgagagctggcgggagcagctggccctg
attgcaggcactgcggttgtgggtgtggtcctggtcctggtggtcgtcatcattgcagtt
ctctgcctcaggaagcagagcaatgggagggaagttgagtactcggataagcatgggcag
tatctcatcgggcacggtaccaaggtctacattgatccttttacttacgaagaccctaat
gaggcagtgagggaatttgccaaagagatcgatgtctcctatgtcaagattgaagaggta
attggtgcaggtgagttcggcgaggtgtgccggggtcggctgaaggcaccagggaaaaag
gagagctgtgtggccatcaagactctgaagggtggctacaccgagcgccagaggcgtgag
ttcctgagcgaggcctccatcatgggccagttcgagcatcccaacatcatccgcctcgag
ggcgtggtcaccaacagtgtgccggttatgatcctcacggaattcatggagaacggagcc
ctggactccttcctgcggctgaacgacgggcagttcacagtcatccagctggtgggcatg
ctgaggggcatcgcctcgggcatgcggtacctggctgaaatgagctatgtccaccgagac
ctggctgctcggaacatcttggtcaacagtaacctggtctgcaaggtgtccgactttggc
ctctccagattcttggaggagaactcctctgatcccacctacacaagttccctgggaggc
aagattcccatccgatggaccgcccctgaagccattgccttcaggaagttcacctctgcc
agtgatgcctggagctatgggatcgtcatgtgggaggtcatgtcttttggggaacggcca
tactgggacatgagcaaccaggatgtgatcaatgccattgaacaggactaccggctgcct
cctcctccagactgccccacctccctccaccagctcatgctggattgttggcagaaggac
cggaatgcccggccccgctttccccaggtggtcagcgctctggacaagatgatccggaat
cccgctagcctcaaaatcgtggccagggagaatggcggggcctcacatccactcttggac
caacggcagcctcactattctgctttcggttctgtgggcgagtggcttcgagccatcaag
atgggaagatacgaggaaagttttgcagcggctggattcggctcctttgaggtggtcagt
cagatctctgccgaggaccttctccgaattggagtcactctggcaggacaccagaagaaa
atcttggccagtgtgcagcatatgaagtcccaagctaagccaggagcccctggtgggaca
gggggaccagcccagcagttctga

DBGET integrated database retrieval system