KEGG   Mus musculus (mouse): 13850
Entry
13850             CDS       T01002                                 

Gene name
Ephx2, CEH, Eph, Eph2, SEH, s, sE, sEP
Definition
(RefSeq) epoxide hydrolase 2, cytoplasmic
  KO
K08726  soluble epoxide hydrolase / lipid-phosphate phosphatase [EC:3.3.2.10 3.1.3.76]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    13850 (Ephx2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    13850 (Ephx2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    13850 (Ephx2)
   01002 Peptidases and inhibitors [BR:mmu01002]
    13850 (Ephx2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.76  lipid-phosphate phosphatase
     13850 (Ephx2)
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.10  soluble epoxide hydrolase
     13850 (Ephx2)
Protein phosphatases and associated proteins [BR:mmu01009]
 HAD phosphatases
  Other HAD phosphatases
   13850 (Ephx2)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S33
   13850 (Ephx2)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 HAD_2 Hydrolase_4 Hydrolase Hydrolase_like
Other DBs
NCBI-GeneID: 13850
NCBI-ProteinID: NP_031966
MGI: 99500
Ensembl: ENSMUSG00000022040
UniProt: P34914 Q3UQ71
Structure
PDB: 
1CR6 1CQZ 1EK2 1EK1

Position
14 D1; 14 34.36 cM
AA seq 554 aa
MALRVAAFDLDGVLALPSIAGAFRRSEEALALPRDFLLGAYQTEFPEGPTEQLMKGKITF
SQWVPLMDESYRKSSKACGANLPENFSISQIFSQAMAARSINRPMLQAAIALKKKGFTTC
IVTNNWLDDGDKRDSLAQMMCELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEV
VFLDDFGSNLKPARDMGMVTILVHNTASALRELEKVTGTQFPEAPLPVPCNPNDVSHGYV
TVKPGIRLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAQAGFRVLAIDMKGYGDSSSP
PEIEEYAMELLCKEMVTFLDKLGIPQAVFIGHDWAGVMVWNMALFYPERVRAVASLNTPF
MPPDPDVSPMKVIRSIPVFNYQLYFQEPGVAEAELEKNMSRTFKSFFRASDETGFIAVHK
ATEIGGILVNTPEDPNLSKITTEEEIEFYIQQFKKTGFRGPLNWYRNTERNWKWSCKGLG
RKILVPALMVTAEKDIVLRPEMSKNMEKWIPFLKRGHIEDCGHWTQIEKPTEVNQILIKW
LQTEVQNPSVTSKI
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggcgctgcgtgtagccgcgttcgaccttgacggagtgctggccctcccctctatcgcc
ggggctttccgccgcagcgaagaggccctggcactgcctagagacttcctgcttggtgcg
taccagacggaattcccagagggacccactgagcaactcatgaaagggaagatcacattt
tcgcagtgggtaccactcatggatgaaagctacaggaagtcctccaaagcctgtggagcc
aatctacctgagaatttctccataagtcaaatattcagccaagctatggcagcaagaagc
atcaaccgccccatgcttcaggcagccattgctctcaaaaagaaaggattcacaacatgc
attgtcaccaacaactggctggacgacggagacaagagagacagcctggcccagatgatg
tgtgagctgagccaacactttgacttcctgatagagtcctgtcaggttgggatgatcaag
cctgagcctcagatctacaattttttactggataccctgaaggcaaaacccaatgaggtt
gttttcctagatgactttggaagtaatctgaagccagcccgtgacatggggatggttacc
atcctggtccacaacacagcctccgctctgagagaactggagaaggtcacagggacacag
tttcctgaggccccactgccagtcccatgcaatccaaatgacgtcagccatggatatgtg
acagtgaagccagggatccgcctgcattttgtggagatgggctctggccctgccctatgc
ctttgccatgggtttcctgagagctggttttcttggaggtaccagatccctgctctggcc
caggcaggctttcgtgttctggctatagacatgaaaggctatggagactcatcttctcct
cctgaaatagaagaatatgccatggaattgctgtgtaaggagatggtgacattcctggat
aagctgggaatccctcaagcagtgttcattggccatgactgggctggtgtgatggtgtgg
aacatggctctcttctaccctgagagagtgagggctgtggccagtttgaacacgccgttt
atgccaccagatcctgatgtgtctcccatgaaagttatccgatctatcccagttttcaat
tatcagctgtactttcaagaaccaggagtggccgaggctgaactggagaagaacatgagt
cggactttcaaaagcttcttccgagccagtgatgagacaggtttcatcgctgtgcataaa
gccactgaaatagggggaatccttgtgaatactccagaagatcccaacctcagcaaaatt
actactgaggaagaaatagagttttacatacagcagttcaagaagactggcttcagaggt
cctctgaactggtaccggaacacagaaagaaactggaagtggagctgtaaagggttggga
cgaaagatcttggtcccagccctgatggtcacagctgagaaggacattgtactccgtcct
gaaatgtccaagaacatggaaaagtggatccctttcctgaaaaggggacacattgaagac
tgtggtcactggacacagatagagaaaccaactgaggtgaaccagattctcatcaagtgg
ctgcagactgaagtccagaacccatcagtgacctccaagatttag

DBGET integrated database retrieval system