KEGG   Mus musculus (mouse): 13852
Entry
13852             CDS       T01002                                 

Symbol
Stx2, AW538950, Ep, Epim, G1-536-1, Syn, Syn-2, rep, repro34
Name
(RefSeq) syntaxin 2
  KO
K08486  syntaxin 1B/2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    13852 (Stx2)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    13852 (Stx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13852 (Stx2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13852 (Stx2)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    13852 (Stx2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   13852 (Stx2)
  Exosomal proteins of other body fluids (saliva and urine)
   13852 (Stx2)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Lge1 Syntaxin-6_N DUF3671 CbiA ApoLp-III COG5 Orf78 Med28 DUF16 DUF2207 LMBR1 DUF2205
Other DBs
NCBI-GeneID: 13852
NCBI-ProteinID: NP_001272962
MGI: 108059
Ensembl: ENSMUSG00000029428
Vega: OTTMUSG00000027708
UniProt: Q3TJ55 Q80W45
Position
5 G1.3; 5 67.99 cM
AA seq 288 aa
MRDRLPDLTACRTNDDGDTAVVIVEKDHFMDGFFHQVEEIRSSIARIAQHVEDVKKNHSI
ILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKSIEQSCDQDENGNRTSVDLRIRRTQH
SVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFISD
IISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNS
VDYVEHAKEETKKAIKYQSKARRKVMFVLICVVTLLVILGIILATALS
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcgggaccggctgcccgacctcacggcgtgtaggacaaacgacgatggagacactgct
gtcgtcattgtggagaaggatcatttcatggacggtttcttccatcaggtagaggagatt
cgaagcagcatagccaggattgctcagcatgtagaagacgtgaagaagaaccacagcatc
atcctgtctgctccaaacccagaaggaaaaataaaagaagagctggaggacctgaacaaa
gagatcaagaaaactgctaacaggatccggggcaagctgaagtctattgagcagagctgt
gatcaggacgagaatgggaaccgaacttcagtggatctgcggatacgaaggacccagcac
tcggtgctgtcacggaagtttgtggacgtcatgacagaatacaatgaagcgcagatcctg
ttccgggagcgaagcaaaggccgcatccagcgccagctggagatcactgggaggaccacc
actgacgacgagctggaagagatgctggagagcgggaagccgtccatcttcatctcggat
attatatcagattcacaaatcactaggcaagctctcaatgagatcgagtcccgccacaaa
gacatcatgaagctggagaccagcatccgagagctgcacgagatgttcatggatatggcc
atgtttgtcgagactcagggtgaaatggtcaacaacatcgagagaaatgtggtgaactct
gtagattacgtggaacatgccaaggaagagacgaagaaagccatcaaataccagagcaag
gccaggcggaaggtgatgttcgtcctcatttgtgtagtcactttgcttgtgatccttgga
attattctcgcaacagcattgtcatag

DBGET integrated database retrieval system