KEGG   Mus musculus (mouse): 13857Help
Entry
13857             CDS       T01002                                 

Gene name
Epor
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    13857 (Epor)
   04151 PI3K-Akt signaling pathway
    13857 (Epor)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13857 (Epor)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    13857 (Epor)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    13857 (Epor)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   13857 (Epor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 13857
NCBI-ProteinID: NP_034279
MGI: 95408
Ensembl: ENSMUSG00000006235
Vega: OTTMUSG00000062323
UniProt: P14753 Q3UTV9
Structure
PDB: 

Position
9 A3; 9 7.93 cM
AA seq 507 aa AA seqDB search
MDKLRVPLWPRVGPLCLLLAGAAWAPSPSLPDPKFESKAALLASRGSEELLCFTQRLEDL
VCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLE
LQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYE
VDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPAS
LLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPGIPSPESEFEGLFTTHK
GNFQLWLLQRDGCLWWSPGSSFPEDPPAHLEVLSEPRWAVTQAGDPGADDEGPLLEPVGS
EHAQDTYLVLDKWLLPRTPCSENLSGPGGSVDPVTMDEASETSSCPSDLASKPRPEGTSP
SSFEYTILDPSSQLLCPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQGVHGDSS
DGPYSHPYENSLVPDSEPLHPGYVACS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcagggtgcccctctggcctcgggtaggccccctctgtctcctacttgct
ggggcagcctgggcaccttcacccagcctcccggaccccaagtttgagagcaaagcggcc
ctgctggcatcccggggctccgaagaacttctgtgcttcacccaacgcttggaagacttg
gtgtgtttctgggaggaagcggcgagctccgggatggacttcaactacagcttctcatac
cagctcgagggtgagtcacgaaagtcatgtagcctgcaccaggctcccaccgtccgcggc
tccgtgcgtttctggtgttcactgccaacagcggacacatcgagttttgtgccgctggag
ctgcaggtgacggaggcgtccggttctcctcgctatcaccgcatcatccatatcaatgaa
gtagtgctcctggacgcccccgcggggctgctggcgcgccgggcagaagagggcagccac
gtggtgctgcgctggctgccacctcctggagcacctatgaccacccacatccgatatgaa
gtggacgtgtcggcaggcaaccgggcaggagggacacaaagggtggaggtcctggaaggc
cgcactgagtgtgttctgagcaacctgcggggcgggacgcgctacaccttcgctgttcga
gcgcgcatggccgagccgagcttcagcggattctggagtgcctggtctgagcccgcgtca
ctactgaccgctagcgacctggaccctctcatcttgacgctgtctctcattctggtcctc
atctcgctgttgctgacggttctggccctgctgtcccaccgccggactctgcagcagaag
atctggcctggcatcccaagcccagagagcgagtttgagggtctcttcaccacccacaag
ggtaacttccagctgtggctgctgcagcgtgatggttgtctgtggtggagcccgggcagc
tccttccctgaggatccacctgcccacctagaggtcctctcagagccacgctgggcagtg
actcaggctggggacccaggggcagatgatgaggggcccttactggagccggtgggcagt
gagcatgcccaggacacctacttggtattggataagtggttgctgccccggaccccatgc
agtgagaacctctcagggcctgggggcagtgtggaccctgtgactatggatgaagcttca
gaaacatcttcctgcccgtctgacttggcctcaaagcccaggccagagggcacctcacct
tccagctttgagtacaccatcctggaccccagctctcagctcctgtgccctcgggcactg
cctcccgagctacctcccactccacctcacttgaagtacctataccttgtggtgtccgat
tctggcatctcaacagattacagttcggggggctctcagggagtccacggggactcatct
gatggcccctactcccacccctatgagaacagccttgtcccagactcagagcctctgcat
cccggctatgtggcctgctcctag

DBGET integrated database retrieval system