KEGG   Mus musculus (house mouse): 13865
Entry
13865             CDS       T01002                                 
Symbol
Nr2f1, COUP-TF1, COUP-TFI, COUPTFA, EAR-3, EAR3, Erbal3, SVP44, Tcfcoup1
Name
(RefSeq) nuclear receptor subfamily 2, group F, member 1
  KO
K08547  COUP transcription factor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13865 (Nr2f1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    13865 (Nr2f1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    13865 (Nr2f1)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2F. COUP-TF like receptor
   13865 (Nr2f1)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 13865
NCBI-ProteinID: NP_034281
MGI: 1352451
Ensembl: ENSMUSG00000069171
UniProt: Q60632 Q32NY6
Position
13:complement(78337090..78346992)
AA seq 420 aa
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGEQQQAGSGAPHTPQTPGQPGAPAT
PGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCR
ANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHC
YLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDL
QITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQ
EQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQ
PSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcaatggtagttagcagctggcgagatccgcaggacgacgtggccgggggcaacccc
ggcggccccaaccccgcagcgcaggcagcccgcggcggcggcggcggcgagcagcagcag
gcgggctccggcgcgccgcacacgccgcagaccccgggccagcccggagcgcccgccacc
cccggcacggcaggggacaagggccagggcccgcccggttcaggccagagccagcagcac
atcgagtgcgtggtgtgcggggacaagtcgagcggcaagcactacggccaattcacctgc
gagggctgcaaaagtttcttcaagaggagcgtccgcaggaacttaacttacacatgccgt
gccaacaggaactgtcccatcgaccagcaccaccgcaaccagtgccaatactgccgcctc
aagaagtgcctcaaagtgggcatgaggcgggaagcggttcagcgaggaagaatgcctcca
acccagcccaatccaggccagtatgcactcacaaacggggatcctctcaatggccactgc
tacctgtctggctacatttctctgctgctgcgcgcagagccctaccccacgtcgcgttat
ggcagccagtgcatgcagcccaacaacatcatgggcatcgagaacatctgcgagctggca
gcccgcctcctcttcagcgccgtcgagtgggcccgcaacatcccgttcttcccggatctg
cagatcacggaccaggtgtctctgctgcgcctcacctggagcgagctgttcgtgctcaac
gcggcccagtgctccatgcccctgcacgtggcgccgctgctggccgcagccggcctgcac
gcctcgcccatgtccgcggaccgcgtcgtggccttcatggaccacatccgcatctttcag
gaacaggtggagaagctcaaggcgctgcacgtcgactctgccgagtacagctgcctcaaa
gccatcgtgctattcacgtcagatgcttgtggcctgtcggatgctgcccacatcgaaagc
ctgcaggagaaatcacagtgtgccctggaggagtatgtgagaagccagtaccccaaccag
cccagccgctttggcaaactgctgctgcgattgccctctcttcgcacagtgtcctcctct
gtcatcgagcaactcttcttcgtacgtttggtaggtaaaactcccatcgaaactctcatc
cgagatatgttgctgtcagggagcagtttcaactggccttacatgtccatccagtgttcc
tag

DBGET integrated database retrieval system