KEGG   Mus musculus (mouse): 13867
Entry
13867             CDS       T01002                                 

Gene name
Erbb3, C76256, Erbb, Erbb-, Erbb-3, Erbb3r, HER, Her3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13867 (Erbb3)
   04012 ErbB signaling pathway
    13867 (Erbb3)
   04020 Calcium signaling pathway
    13867 (Erbb3)
   04151 PI3K-Akt signaling pathway
    13867 (Erbb3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13867 (Erbb3)
   05205 Proteoglycans in cancer
    13867 (Erbb3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13867 (Erbb3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13867 (Erbb3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13867 (Erbb3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13867 (Erbb3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like CD34_antigen APH SKG6
Other DBs
NCBI-GeneID: 13867
NCBI-ProteinID: NP_034283
MGI: 95411
Ensembl: ENSMUSG00000018166
Vega: OTTMUSG00000029881
UniProt: Q61526
Position
10 D3; 10 77.1 cM
AA seq 1339 aa
MSAIGTLQVLGFLLSLARGSEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILLGGVYIEKNDKLCHMDTIDWRDIVRVPDAEIVVKNNG
GNCPPCHEVCKGRCWGPGPEDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPAPLVYNKLTFQLEPNPHIKYQYGGVCVASCPHNFVVDQTF
CVRACPADKMEVDKNGLKMCEPCRGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPAEE
RLDIKYNRPLGECVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNVLQGEP
REFVHEAHCFSCHPECQPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPI
YKYPDAQNECRPCHENCTQGCKGPELQDCLGQAEVLMSKPHLVIAVTVGLTVIFLILGGS
FLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGT
VHKGIWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAVGSLDHAHIVRLLGLCPGSS
LQLVTQYLPLGSLLDHVRQHRETLGPQLLLNWGVQIAKGMYYLEEHSMVHRDLALRNVML
KSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVW
ELMTFGAEPYAGLRLAEIPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELA
NEFTRMARDPPRYLVIKRASGPGIPPAAEPSALSTKELQDAELEPDLDLDLDVEVEEEGL
ATTLGSALSLPTGTLTRPRGSQSLLSPSSGYMPMNQSNLGEACLDSAVLGGREQFSRPIS
LHPIPRGRQTSESSEGHVTGSEAELQERVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPV
TPLSPPGLEEEDGNGYVMPDTHLRGTSSSREGTLSSVGLSSVLGTEEEDEDEEYEYMNRK
RRGSPARPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHPMAIVPSAGTTPDEDYEYM
NRRRGAGGSGGDYAAMGACPAAEQGYEEMRAFQGPGHQAPHVRYARLKTLRSLEATDSAF
DNPDYWHSRLFPKANAQRI
NT seq 4020 nt   +upstreamnt  +downstreamnt
atgagtgcgattgggactctgcaggtgctgggtttccttctcagcctggcccggggttcc
gagatgggcaactctcaggcagtatgtcctgggactctaaacgggctgagtgtgaccggc
gatgctgacaaccagtaccagacactgtacaaactctatgagaagtgtgaggtggtcatg
ggtaacctggagattgtgcttacgggacacaatgctgatctttccttcctgcaatggatc
cgagaagtgacaggctatgtactggtggccatgaatgaattctctgtactgcccttacct
aacctccgagtggtccggggaacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactacaataccaactccagccatgctctgcgccagctccggttcactcagcttact
gagattctgttagggggcgtttacattgagaagaatgacaaactttgccacatggataca
attgactggagggacatcgtgagggttccagacgctgagatagtggtgaagaacaacggg
gggaactgtccaccctgtcacgaagtctgcaaggggcgatgctgggggcctggaccagaa
gactgccagatattgaccaagaccatctgtgcccctcagtgtaacggtcgctgcttcggg
cccaatcctaaccagtgctgccacgatgaatgtgcaggtggctgctctggaccccaggac
acagattgcttcgcctgccgacacttcaatgacagtggtgcctgtgtgcccaggtgtcca
gcgccccttgtgtacaacaagctaacgttccagcttgagcccaacccccatatcaagtat
cagtacggaggagtctgtgttgccagttgtccccataactttgtggtggatcagacattt
tgtgtcagggcttgtcctgctgacaagatggaagtagataagaatggactcaagatgtgt
gagccttgcagagggctgtgcccaaaagcctgtgaggggacgggctctggaagccgctac
cagaccgtggactctagcaatatcgatgggttcgtgaactgtaccaagatcctgggcaac
ctggacttcctcatcactggcctcaatggtgacccctggcacaagatccctgcactggac
ccggaaaagctcaatgttttcaggacagtccgggagattacaggctacctaaacatccag
tcctggccccctcacatgcacaacttcagtgttttttccaacctgacgaccatcgggggc
agaagcctctacaatcggggcttctccttgttgatcatgaagaacttgaatgtcacgtct
ctgggcttccggtccctgaaggaaattagtgctgggcgtgtctacataagtgccaatcag
caactttgttaccaccactctctgaactggaccagacttctgcgggggcccgcagaggag
agacttgacatcaagtacaaccggcctctgggagaatgcgtggcagagggcaaagtgtgt
gatccactgtgctcctctgggggatgctggggcccaggccctggtcagtgcttgtcttgt
cgaaactacagccgggaaggtgtctgtgtgactcactgcaacgttctgcaaggggaaccc
cgagagtttgttcatgaggctcattgcttctcctgccatccagaatgccagcccatggag
ggcaccagcacgtgcaatggctcgggctccgacgcttgtgctcgatgcgcccattttcgt
gatgggccccactgtgtgaacagctgcccccatggaatcctaggtgccaaaggtccaatc
tacaaatatccagatgctcagaatgagtgccggccctgccacgagaactgcacccaaggg
tgtaagggaccagaactacaagactgtttaggccaagcagaggtattaatgagcaaacca
cacctggtcatagcggtgacagtaggactgactgtgatcttcctgattctgggaggctct
tttctctattggcgtggacgcaggattcagaataaaagggctatgagacgctacttggag
cggggtgagagcatcgagcctctggacccaagcgagaaggcaaacaaagtcttggctaga
atcttcaaagagacagagctgaggaaacttaaggtgcttggctctggtgtctttggaact
gtacacaaggggatttggattcccgagggtgaatccatcaagattccagtctgcattaaa
gtcatcgaggacaagagtgggcggcagagttttcaggctgtgactgatcacatgctggcc
gtcggcagcctggaccatgcccacattgtacggctgctgggactgtgcccagggtcatct
ctgcagcttgtcactcagtacttgcctctgggctctctccttgatcatgtaagacagcac
cgtgagacactgggaccacagctgctgctcaactggggagtacaaattgccaagggtatg
tattacctcgaggaacacagcatggtgcatagggaccttgcgctccggaatgtgatgctt
aagtcaccgagtcaagtccaggtggcagattttggtgtggctgacttgctgccgccagat
gacaagcagttactacacagtgaggccaagactccaattaaatggatggcccttgagagt
atccactttgggaaatacacacaccagagtgatgtctggagttacggtgtaaccgtttgg
gagttgatgaccttcggggcagagccctacgcagggctacgactggctgaaataccagac
ctgctggagaagggagagcggttagcacagccccagatctgcaccattgacgtctacatg
gtcatggtcaagtgttggatgattgacgagaatattcgcccaacctttaaagaactggcc
aatgagtttaccaggatggcccgggacccaccaaggtatctggtcatcaagagagcgagt
gggcctggaatacctcctgcagcagagccatctgctctgagcaccaaagagttgcaggat
gcagagctggagccagacctggacctcgacctagacgtggaggtagaagaggagggcctg
gcgaccacactgggttctgccctcagcttgcctacaggaacgcttacccggccacgtggg
agccagagtcttttaagtccttcgtctggatacatgcccatgaaccagagcaaccttggg
gaggcttgtctggattctgcggttttggggggtcgcgaacagttctcccgtcccatctct
ctgcacccgatcccacgggggcgtcaaacgtcagagtcatcagagggccatgtgacgggc
tctgaggctgaactccaagagagagtatcaatgtgtaggagccggagccggagccggagc
ccacggccacgtggggacagtgcctaccattcgcagcgacacagcctgcttactcccgtc
accccgctctccccaccagggttagaggaagaggatggcaatggttatgtcatgccagat
acgcacctcagaggtacatcctcttcccgggaaggcaccctttcgtcagtaggtctcagt
tctgtgctgggtaccgaagaggaagatgaagatgaggagtatgaatacatgaaccggaag
aggaggggtagcccggctcggccccccagacctggttccctggaagagctgggctatgag
tacatggatgtgggttcagacctcagtgcttctctgggcagtacgcagagttgcccactc
catcccatggccatcgtgccctctgctggcacgactccagatgaggactatgaatacatg
aaccgcaggcgtggtgcgggcggttccggaggggattatgcagctatgggggcctgccca
gcagctgaacaagggtatgaggaaatgcgagctttccaggggcctggacatcaagccccc
catgttcgttatgcccgcctcaaaactctgcgtagtttagaagccactgactccgccttt
gacaaccccgattactggcatagcaggcttttccctaaggctaacgcccagagaatttga

DBGET integrated database retrieval system