KEGG   Mus musculus (mouse): 13874
Entry
13874             CDS       T01002                                 

Gene name
Ereg, E, EPR
Definition
(RefSeq) epiregulin
  KO
K09784  epiregulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13874 (Ereg)
   04012 ErbB signaling pathway
    13874 (Ereg)
   04151 PI3K-Akt signaling pathway
    13874 (Ereg)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    13874 (Ereg)
SSDB
Motif
Pfam: EGF EGF_2 Sigma_reg_N EphA2_TM DUF2207
Other DBs
NCBI-GeneID: 13874
NCBI-ProteinID: NP_031976
MGI: 107508
Ensembl: ENSMUSG00000029377
Vega: OTTMUSG00000055519
UniProt: Q61521
Position
5; 5 E1
AA seq 162 aa
METLPASWVLTLLCLGSHLLQAVISTTVIPSCIPGESEDNCTALVQMEDDPRVAQVQITK
CSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFLTVHQPLSKEYVALTVILIF
LFLIITAGCIYYFCRWYKNRKSKKSREEYERVTSGDPVLPQV
NT seq 489 nt   +upstreamnt  +downstreamnt
atggagacgctccctgcctcttgggtcttgacgctgctttgtctaggttcccaccttcta
caggcagttatcagcacaaccgtgatcccatcatgcatcccaggagaatccgaggataac
tgtaccgccttagttcagatggaagacgatccccgtgtggctcaagtgcagattacaaag
tgtagttctgacatggacggctactgcttgcatggccagtgcatctacctggtggacatg
agagagaaattctgcagatgtgaagtgggctacactggtctgcgatgtgagcacttcttt
ctaactgttcaccaacccttgagcaaagaatacgttgcgttgacagtgattctcattttc
ctgtttctcatcataaccgctggatgcatatactatttctgcagatggtacaaaaatcga
aaaagtaaaaaatcgagggaggaatatgagagagtgacctcaggggacccagtgctgcca
caggtctga

DBGET integrated database retrieval system