KEGG   Mus musculus (mouse): 13876
Entry
13876             CDS       T01002                                 

Gene name
Erg, D030036I24Rik
Definition
(RefSeq) ETS transcription factor
  KO
K09435  transcriptional regulator ERG
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13876 (Erg)
  09162 Cancer: specific types
   05215 Prostate cancer
    13876 (Erg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13876 (Erg)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    13876 (Erg)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 Arb2
Other DBs
NCBI-GeneID: 13876
NCBI-ProteinID: NP_598420
MGI: 95415
Ensembl: ENSMUSG00000040732
Vega: OTTMUSG00000026424
UniProt: P81270
Position
16 C4; 16 56.04 cM
AA seq 486 aa
MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQ
QDWLSQAPARVTIKMECNPSQVNGSRNSPDECSVNKGGKMVGSPDTVGMSYGSYMEEKHV
PPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLLDVDVLLFQNIDGKELCKMTK
DDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPN
TSVYPEATQRITTRPDLPYEPPRRSAWTGHSHLTPQSKAAQPSPSAVPKTEDQRPQLDPY
QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGE
RKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS
DLPYMGSYHAHPQKMNFVSPHPPALPVTSSSFFASPNPYWNSPTGGIYPNTRLPASHMPS
HLGTYY
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgatccagactgtacctgacccagcagctcatattaaggaggccttgtcagttgtgagc
gaggaccagtcactatttgagtgtgcctacggaacgccacacctggctaagacagagatg
accgcatcctcttccagtgactatggccagacatccaagatgagtcccagagtccctcag
caggactggctgtctcaagccccagccagggtcaccatcaagatggagtgcaaccctagt
caggtgaatggttccaggaactcacctgatgagtgcagtgtgaacaaaggtgggaagatg
gtgggcagcccggatactgtggggatgagctacggcagctacatggaggagaagcatgtg
ccgcctcccaatatgaccacaaatgagcgcagagtgatcgtccctgcagatcctactctg
tggagcacagaccatgtccgacagtggctggagtgggcggtgaaagaatatggcctcctc
gatgtggacgtcttactatttcagaatatcgatgggaaggagctgtgcaagatgacaaag
gatgacttccagcggctcacgccgagctacaatgccgacattcttctctcacatctccac
tacctcagagagactccccttccacatctgacttccgatgacgttgataaggctttacaa
aactctccacggttaatgcatgccagaaacacagggggtgcagcttttattttcccaaat
acttcagtatatcccgaagctacgcaaagaattacaactaggccagatttaccttatgag
cctcccaggagatcagcctggaccggccacagccacctcacccctcagtccaaagctgct
cagccatctccctctgcagtgcccaaaactgaagaccagcgtcctcagttagatccttac
cagatcctgggaccgaccagtagccgccttgctaatccaggtagtggccagatccagctg
tggcagttcctgctcgaactcctgtcagacagctccaactccaactgcatcacctgggaa
ggcaccaacggggagttcaagatgacagacccggacgaggtggctcggcgctggggggag
aggaagagcaagcccaacatgaactatgacaagctcagccgcgccctccgctactactac
gacaaaaacatcatgaccaaggtgcacgggaagcgctacgcctacaagtttgacttccac
gggattgcccaggccctgcagccccaccctcctgagtcgtccctgtacaagtacccctcc
gacctgccatacatgggctcctatcacgcccacccccagaagatgaactttgtgtctccc
caccctcccgctctcccagtcacatcttccagtttctttgcttccccgaacccatactgg
aattcaccgactgggggcatctacccgaacactaggctcccagccagccatatgccctct
cacctgggcacctactactag

DBGET integrated database retrieval system