KEGG   Mus musculus (mouse): 13877
Entry
13877             CDS       T01002                                 

Symbol
Erh, Mer, Prei1
Name
(RefSeq) ERH mRNA splicing and mitosis factor
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: ER
Other DBs
NCBI-GeneID: 13877
NCBI-ProteinID: NP_031977
MGI: 108089
Ensembl: ENSMUSG00000021131
Vega: OTTMUSG00000035813
UniProt: P84089 Q4FZH7
Structure
Position
12:complement(80680795..80690885)
AA seq 104 aa
MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDF
IDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
NT seq 315 nt   +upstreamnt  +downstreamnt
atgtctcacaccattttgctggtacagcctaccaagaggccagagggcaggacttatgct
gactatgagtctgtgaatgagtgcatggaaggtgtttgtaaaatgtatgaagaacatctg
aagaggatgaatcccaacagcccttccatcacatacgatatcagccagttgtttgatttt
attgacgatctggcagacctcagctgtctggtttaccgagctgatacacagacataccag
ccgtataacaaagactggatcaaagagaagatctacgtgctcctccgtcggcaggcccaa
caggctgggaagtaa

DBGET integrated database retrieval system