KEGG   Mus musculus (mouse): 13897Help
Entry
13897             CDS       T01002                                 

Gene name
Ces1e, Eg, Es-22, Es22, egasyn
Definition
(RefSeq) carboxylesterase 1E
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    13897 (Ces1e)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     13897 (Ces1e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180 Esterase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 13897
NCBI-ProteinID: NP_598421
MGI: 95432
Ensembl: ENSMUSG00000061959
Vega: OTTMUSG00000024535
UniProt: Q64176 Q3UN14
Position
8 C5; 8 45.11 cM
AA seq 562 aa AA seqDB search
MCLSALILVSLAAFTAGAGHPSSPPMVDTVQGKVLGKYISLEGFTQPVAVFLGVPFAKPP
LGSLRFAPPQPAEPWSSVKNATSYPPMCFQDPVTGQIVNDLLTNRKEKIPLQFSEDCLYL
NIYTPADLTKSDRLPVMVWIHGGGLVLGGASTYDGLVLSTHENVVVVVIQYRLGIWGFFS
TGDEHSRGNWGHLDQVAALHWVQDNIAKFGGDPGSVTIFGESAGGESVSVLVLSPLAKNL
FQRAISESGVALTAGLVKKNTRPLAEKIAVISGCKNTTSAAMVHCLRQKTEEELLGTTLK
LNLFKLDLHGDSRQSHPFVPTVLDGVLLPKMPEEILAEKNFNTVPYIVGINKQEFGWILP
TMMNYPPSDVKLDQMTAMSLLKKSSFLLNLPEDAIAVAIEKYLRDKDYTGRNKDQLLELI
GDVVFGVPSVIVSRGHRDAGAPTYMYEFQYSPSFSSEMKPDTVVGDHGDEIYSVFGAPIL
RGGTSEEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKE
KEVAFWTELLAKKQLPTEHTEL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctctctgctctgatcctggtgtcacttgcagcattcacagcaggggcaggacat
ccatcctcaccacccatggtggacaccgtgcaaggcaaagtcctggggaagtacatcagc
ttagaaggattcacacagcctgtggccgtcttcctgggagtcccctttgccaagccccct
cttggatctctgaggtttgctccaccacagcctgcagagccctggagctccgtgaagaat
gccacctcctaccctcctatgtgcttccaagacccagtgacagggcaaatagtcaatgac
ctcctaactaacagaaaggagaaaattcctctccagttttctgaagactgtctctacctg
aatatttacactccagctgacttgacaaagagtgacagattgccagtgatggtgtggatc
catggaggtggactagtgttaggtggggcatcaacctatgatggactggtcctgtctacg
catgaaaatgtcgtggtggtggtcatccaataccgtttgggcatctggggattcttcagc
acaggggatgaacacagcagggggaactggggtcacttggaccaggtggctgcactacac
tgggtccaggacaacattgctaaatttggaggtgacccaggctctgtgaccatctttgga
gagtcagcaggaggtgaaagtgtctctgttcttgtgttgtctcccttggccaagaatctc
ttccagagggctatttctgaaagtggtgtggccctcactgcaggcctggtcaagaagaac
accaggcctttggctgagaaaattgctgtcatatctggttgtaaaaacaccacttccgct
gccatggttcactgccttcgccagaagacagaggaagagctcttggggaccacactaaaa
ttgaatctttttaagctggatttgcatggagactccagacagagccatccctttgttccc
actgtgcttgatggagtgttgctgccaaagatgcctgaggagatcctggctgagaagaac
ttcaacacagtgccctacatcgtgggaatcaacaagcaagagtttggctggattctgcca
actatgatgaactacccaccctctgatgtgaaattggaccagatgacggccatgtctctc
ttgaagaagtcctcttttcttcttaacctccctgaggatgcaattgcagtggccattgag
aagtatttaagagataaagattacacaggcagaaataaagaccaacttctggaattgatt
ggggatgtggtattcggtgtaccatctgtgattgtgtcccgtggacatagagatgccgga
gcccccacatacatgtatgagtttcaatatagtccaagcttctcgtcagaaatgaaacca
gatacggtggtaggagaccatggagatgaaatctactctgtctttggggccccaatttta
agaggtggtacctcagaagaggagatcaacctcagcaagatgatgatgaaattctgggcc
aactttgctaggaatgggaatcccaatggacaagggctgccccattggccagagtatgac
caaaaggaaggttatctgcagattggagccaccacccaacaagcccagaagctgaaagaa
aaagaagtggctttctggactgaacttctggctaagaagcaactgccgacagaacacact
gagctgtga

DBGET integrated database retrieval system