KEGG   Mus musculus (house mouse): 13924
Entry
13924             CDS       T01002                                 
Symbol
Ptprv, Esp, OST, OST-PTP
Name
(RefSeq) protein tyrosine phosphatase, receptor type, V
  KO
K18036  receptor-type tyrosine-protein phosphatase V [EC:3.1.3.48]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    13924 (Ptprv)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     13924 (Ptprv)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    13924 (Ptprv)
SSDB
Motif
Pfam: Y_phosphatase fn3 PTP_tm Y_phosphatase3 DSPc PTPlike_phytase Y_phosphatase2
Other DBs
NCBI-GeneID: 13924
NCBI-ProteinID: NP_031981
MGI: 108027
Ensembl: ENSMUSG00000097993
Position
1:complement(135036236..135060313)
AA seq 1705 aa
MRPPILLAALLWLQDSLAQEDVCSSLDGSPDRQGGGPPLSVNVSSRGKPTSLFLSWVAAE
PGGFDYALCLRAMNLSGFPEGQQLQAHTNESSFEFHGLVPGSRYQLELTVLRPCWQNVTI
TLTARTAPTVVRGLQLHSTGSPASLEASWSDASGDQDSYQLLLYHPESHTLACNVSVSPD
TLSYNFGDLLPGSQYVLEVITWAGSLHAKTSILQWTEPVPPDHLTLRALGTSSLQAFWNS
SEGATWFHLILTDLLEGTNLTKVVRQGISTHTFLRLSPGTPYQLKICAAAGPHQIWGPNA
IEWTYPSYPSDLVLTPLWNELWASWKAGQGARDGYVLKLSGPVENTTTLGPEECNAVFPG
PLPPGHYTLGLRVLAGPYDAWVEGSIWLAESAARPMEVPGARLWLEGLEATKQPGRRALL
YSVDAPGLLGNISVSSGATHVTFCGLVPGAHYRVDIASSMGDITQSLTGYTSPLPPQSLE
IISRNSPSDLTIGWAPAPGQMEGYKVTWHQDGSQRSPGDLVDLGPDISSLTLKSLVPGSC
YTVSAWAWSGNLSSDSQKIHSCTRPAPPTNLSLGFAHQPATLRASWCHPPGGRDAFQLRL
YRLRPLTLESEKILSQEAQNFSWAQLPAGYEFQVQLSTLWGSEESGSANTTGWTPPSAPT
LVNVTSEAPTQLHVSWVHAAGDRSSYQVTLYQESTRTATSIVGPKADSTSFWGLTPGTKY
KVEAISWAGPLYTAAANVSAWTYPLTPNELLASMQAGSAVVNLAWPSGPLGQGTCHAQLS
DAGHLSWEQPLSLGQDLLMLRNLIPGHTVSLSVKCRAGPLQASTHPLVLSVEPGPVEDVF
CQPEATYLSLNWTMPTGDVAVCLVEVEQLVPGGSAHFVFQVNTSEDALLLPNLTPTTSYR
LSLTVLGGNRQWSRAVTLVCTTSAEVWHPPELAEAPQVELGTGMGVTVTRGMFGKDDGQI
QWYGIIATINMTLAQPSQEAINHTWYDHYYRGHDSYLALLFPNPFYPEPWAVPRSWTVPV
GTEDCDNTQEICNGHLKPGFQYRFSIAAFSRLSSPETILAFSAFSEPQASISLVAMPLTV
MMGTVVGCIIIVCAVLCLLCRRRLKGPRSEKNGFSQELMPYNLWRTHRPIPSHSFRQSYE
AKSARAHQAFFQEFEELKEVGKDQPRLEAEHPANITKNRYPHVLPYDHSRVRLTQLSGEP
HSDYINANFIPGYSHPQEIIATQGPLKKTLEDFWRLVWEQQVHVIIMLTVGMENGRVLCE
HYWPVNSTPVTHGHITTHLLAEESEDEWTRREFQLQHGAEQKQRRVKQLQFTTWPDHSVP
EAPSSLLAFVELVQEEVKATQGKGPILVHCSAGVGRTGTFVALLRLLRQLEEEQVVDVFN
TVYILRLHRPLMIQTLSQYIFLHSCLLNKILEGPSDASDSGPIPVMNFAQACAKRAANAN
AGFLKEYRLLKQAIKDETGSLLPSPDYNQNSIASCHHSQEQLALVEESPADNMLAASLFP
GGPSGRDHVVLTGSAGPKELWEMVWEHGAYVLVSLGLPDTKEKPQDIWPMEMQPIVTDMV
TVHRVAESNTAGWPSTLIRVIHGDSGTERQVQCLQFPHCETGSELPANTLLTFLDAVGQC
CSRGNSKKPGTLLSHSSKVTNQLSTFLAMEQLLQQAGTERTVDVFSVALKQTQACGLKTP
TLEQYIYLYNCLNSALRNRLPRARK
NT seq 5118 nt   +upstreamnt  +downstreamnt
atgaggcccccgattctgttagctgccctcctctggctccaggactctttggcccaggaa
gatgtatgctcatccttggatgggagcccagacaggcagggtggaggtccacctctgagt
gtgaacgtcagcagccgcggaaagcctaccagcctgtttctgagctgggtagctgcagag
ccaggtggatttgactatgccctctgcctcagggctatgaacttgtcgggttttccagaa
gggcaacagctccaagctcataccaacgagtccagctttgagttccatggcctggtgcca
gggagtcgctaccagctggaactgactgtcctaagaccctgttggcagaatgtcacaatt
accctcactgctcgaactgcccctacagtggtccgtggactgcaactgcatagcactggg
agcccagccagcctggaagcctcatggagcgatgcctctggggatcaagacagctatcaa
cttctcctctaccacccggaatcccacactctggcatgtaatgtctctgtgtcccctgac
accctgtcttacaattttggtgacctcttgccaggtagtcagtatgtcttggaggttatc
acctgggctggcagtctccatgcgaagactagcatcctccaatggacagagcctgtccct
cctgatcacctaacactgcgtgccttgggtaccagtagcctgcaagccttctggaacagc
tctgaaggggccacctggtttcacctgatacttacagacctcctagagggtaccaacctg
accaaagtggtcagacaaggcatctcaacccacaccttccttcgcctgtctccgggtaca
ccttaccagctgaagatctgtgctgctgctgggccccaccagatttggggacccaatgcc
attgagtggacctatccctcttacccatctgacctggtgctgacccccttatggaatgag
ctctgggcaagctggaaggcagggcagggagcccgggatggctatgtactgaagttaagt
gggccagtggagaatacaactactctgggtcctgaggagtgcaacgctgtcttcccaggg
cccctgcctccaggacactacactttggggctgagggttctagctggaccttatgatgcc
tgggtagagggcagtatctggctggctgaatctgctgctcgtcccatggaggtccctggt
gccagactgtggctagaaggactggaagctactaagcaacctgggagacgggcgctgctc
tattctgttgatgccccaggcctcctagggaacatctctgtgtcttctggtgccactcat
gtcaccttctgtggcttggtacccggagcgcactacagggtggacattgcctcatccatg
ggagacatcactcagagcctcacaggctacacaagtcccctgccaccacagtctctggag
atcatcagccggaacagcccatctgacctgactatcggttgggctccagcaccagggcag
atggaaggttataaggtcacctggcatcaggatggcagccagaggtcacctggcgacctt
gttgacttgggccctgacatttcgagcctgactctgaaatctctggtacctggttcctgc
tacaccgtgtcagcatgggcctggtctgggaacctcagctctgactctcagaagattcac
agttgcacccgtcccgctcctcccaccaacctgagcctgggctttgcccaccagcctgca
acactgagggcttcctggtgtcacccaccgggtggcagggatgcctttcagttacggctt
tacaggctgaggcccctgacactggaaagtgagaagatcctatcccaggaggcccagaac
ttctcctgggcccagctgcctgcaggctatgaattccaggtacagctgtctaccttgtgg
gggtcggaggagagcggcagtgccaacaccacaggctggacacccccctcagctcctaca
ttggtaaatgtgaccagtgaagcccccacccagctccacgtatcctgggtccacgctgct
ggggaccggagcagctaccaagtgaccctataccaggagagcactcggacagccaccagc
attgtggggcccaaggcagacagcacaagcttttggggtttgactcctggcactaagtac
aaggtggaagccatctcctgggctgggcccctttacactgcagcagccaacgtttctgct
tggacctacccactcacacccaatgagctgctcgcctctatgcaggcaggcagtgctgtg
gttaacctggcctggcccagtggtcccttggggcaagggacatgccatgcccaactctca
gatgctggacacctttcatgggagcaaccgctgtcgctaggccaagacctcctcatgcta
aggaatcttataccaggacatacggtttcattgtctgtgaagtgtcgggcaggaccactc
caggcctccactcaccccctggtgctgtctgtagagcctggccctgtggaagatgtgttc
tgtcaacctgaggccacctacctgtccctgaactggacgatgcctactggagatgtggct
gtctgtctggtggaggtagagcagctggtgccaggagggagcgctcattttgtcttccag
gtcaacacctcggaggatgcacttctgctgcccaacttgacgcccaccacttcttaccgc
cttagcctcactgtgctgggtgggaatcgccagtggagccgggcggttaccctggtgtgc
actacttctgctgaggtttggcaccccccagagctagctgaggccccccaggtggagctg
gggacagggatgggtgtgacagtcacacgtggcatgtttggtaaagatgacgggcagatc
cagtggtatggcataattgccaccatcaacatgacactggcccagccttcccaggaagcc
atcaaccacacatggtatgaccactactatagaggacatgactcctacctggctctcctg
ttcccaaaccccttctacccagagccttgggctgtgccaagatcctggacagtacctgtg
ggtacagaggactgtgacaacacccaggagatatgcaatgggcatctcaagccaggcttc
cagtataggttcagcattgcagcctttagtaggctcagctctccagagaccatcctggcc
ttctccgccttctcagagcctcaggctagcatctctctggtggccatgcccctgacagtt
atgatggggactgtggtgggctgcatcatcattgtgtgtgcagtgctatgcttgttgtgc
cggcggcgcctgaagggaccaaggtcagagaagaatggcttttcccaggagttgatgcct
tacaacctgtggcggacccatcggcccatccccagccatagcttccggcagagctatgag
gccaagagtgcacgtgcacaccaggccttcttccaggaatttgaggagctgaaggaggtg
ggcaaggaccagcccagactagaggctgagcatcctgccaacatcaccaagaaccggtac
ccacacgtgctaccttatgaccactccagggtcaggctgacccagctatcaggagagcct
cattctgactacatcaatgccaacttcatcccaggctatagccacccacaggagatcatt
gccacccaggggcctctcaaaaagacgctcgaggacttctggcggttggtgtgggagcag
caagtccacgtgatcatcatgctaactgtgggcatggagaatgggcgggtactgtgtgag
cactactggccagtcaactccacgcctgtcacccacggtcacatcaccacccacctcctg
gcagaggaatctgaggacgagtggaccaggagggaattccagctgcagcacggtgcagag
caaaaacagaggcgcgtgaagcagctgcagttcacgacctggccagaccacagtgtcccc
gaggctcccagctctctgctcgcttttgtggaactggtgcaggaggaggtgaaggcaact
cagggcaaggggcccatcctggtgcattgcagtgcgggtgtgggcaggacaggcaccttt
gtggctctcttacggctgttgcgacaactagaggaagaacaggtggtcgatgtgttcaac
actgtgtacatactccggctgcaccggcccctcatgatccagaccttgagtcaatacatc
ttcctgcacagctgcctgctgaacaagattctggaagggccctctgacgcctcagactcc
ggccccatccctgtgatgaattttgcacaagcttgtgccaagagggcagccaatgccaat
gccggtttcttgaaggagtacaggctcctgaagcaggccatcaaggatgagactggctct
ctgctgccctctcctgactataatcagaacagcatcgcctcctgtcatcattctcaggag
cagttggccctggtggaggagagccctgctgataacatgctggcagcctcgctcttccct
ggtgggccgtctggtcgcgaccatgtggtgctgactggctcggccggaccaaaggaactc
tgggaaatggtgtgggaacatggcgcctatgtgcttgtctccctgggtctgcctgatacc
aaggagaagccacaagacatctggccaatggagatgcagcctattgtcacagacatggtg
acagtgcacagagtggctgagagcaacacagctggctggcccagtaccctcatcagagtt
atacatggggacagtgggacggaaaggcaggttcaatgcctgcagtttccacactgcgag
actgggagtgagctcccagctaacaccctactgaccttccttgatgctgtgggccagtgc
tgctcccggggcaatagcaagaagccagggaccctgctcagtcactccagcaaggtcaca
aaccagctgagcaccttcttggctatggaacagctgctacagcaagcagggaccgagcgc
acagtggatgtcttcagtgtggccctgaagcagacacaggcctgtggccttaagacccca
acgctggagcagtatatctacctctacaactgtctgaacagcgcattgaggaacaggctg
ccccgagctaggaagtga

DBGET integrated database retrieval system