KEGG   Mus musculus (mouse): 13929
Entry
13929             CDS       T01002                                 

Gene name
Amz2, AA408420, ESTM1, ESTM12, X83328
Definition
(RefSeq) archaelysin family metallopeptidase 2
  KO
K06974  archaemetzincin [EC:3.4.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13929 (Amz2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     13929 (Amz2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M54
   13929 (Amz2)
Motif
Pfam: Peptidase_M54 Peptidase_M10 Peptidase_M43 Reprolysin_5 Peptidase_M57 Reprolysin_3 DUF4953
Other DBs
NCBI-GeneID: 13929
NCBI-ProteinID: NP_001239122
MGI: 104837
Ensembl: ENSMUSG00000020610
Vega: OTTMUSG00000003345
UniProt: Q400C8 B1AT59
Position
11 E1; 11 71.89 cM
AA seq 363 aa
MADKMQVLRHSEHTLKTALLSKNPVLVSQYEKLDAGEQRLMNEAFQPRSNLFEPITVHSQ
SDWISSHPEAPQDFEQFFSDRYRKAPCPKKHIIYIQSIGSLGNTRVISEEYIKWLKGYCE
AFFYGLKVKFLEPVSVSETKCSFRVNEHTQNLQIHTGHILAFLKKNKPEDAFCIVGITMI
DLYPRDSWNFVFGQASLSSGVGIFSFARYGKDFYTSKYEGNVTSLQLTSPTDYSIFDNYY
IPEITSVLLLRSCKTLTHEIGHILGLRHCQWLACLMQGSNHLEESDRRPLNVCPICLRKL
QSAIGFNIVERYRALVKWIDDESCNESGATPKSSSEHAHLPKPVEAFKDWREWLMRCIAL
LEK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggctgacaagatgcaggtactacggcactccgagcacacactgaaaacagctctcctc
tcaaagaacccagtgcttgtgtcacagtatgagaagttagatgctggggagcaacggtta
atgaatgaagccttccagccacgcagtaacctgtttgagcccattactgtgcactcccag
tcagactggatctcctcccaccccgaggctccccaagactttgagcagtttttctctgac
cgctacagaaaggcaccctgtccaaagaaacatataatctacattcagtccattggctct
ctaggcaacaccagagtcatcagtgaagagtatattaaatggctcaagggctactgtgaa
gcatttttctacggtttgaaggtgaagttcttagaacctgtttcggtctctgaaaccaag
tgttcctttagagtgaatgagcacacacaaaacctgcaaatccacacaggacatatcctg
gcattcttgaagaagaataaaccggaagatgccttctgcatcgtggggatcacaatgatc
gatctctaccctcgggactcgtggaacttcgtctttggacaggcctccttgtcaagtggt
gtgggcatattcagctttgccaggtatggcaaggacttctacacctcgaaatacgaaggc
aatgtgacgtctctgcagctaacgtctcccactgactactccatttttgataactattac
atccctgaaatcactagtgttttgctgttgcgatcctgtaagactttaacccatgagatc
ggacacatacttggactgcgacactgccagtggcttgcgtgtttaatgcaaggctccaat
cacttggaggaatctgaccggcgtcctctgaatgtttgccctatctgcttacgaaagctg
cagagtgccattggcttcaatattgtggagagatacagagcactggtgaagtggattgac
gacgaatcttgcaacgaatcaggagcaactccgaaaagtagttctgagcatgcgcatttg
ccgaaacctgtggaagcctttaaggattggagagagtggctaatgagatgcattgctctc
cttgagaaataa

DBGET integrated database retrieval system