KEGG   Mus musculus (mouse): 13972
Entry
13972             CDS       T01002                                 

Symbol
Gnb1l, ESTM55, Gm16314, Me49f07, Wdr14, Wdvcf
Name
(RefSeq) guanine nucleotide binding protein (G protein), beta polypeptide 1-like
  KO
K24732  guanine nucleotide-binding protein subunit beta-like protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    13972 (Gnb1l)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   13972 (Gnb1l)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 13972
NCBI-ProteinID: NP_001075151
MGI: 1338057
Ensembl: ENSMUSG00000000884
Vega: OTTMUSG00000021511
UniProt: Q9EQ15
Position
16 A3; 16 11.46 cM
AA seq 326 aa
MAALFPPPPGPRFVLRGTQSAVNTLHFCPPSQAAGNPLLFSGSQNGLVHIWSLQTRRIVT
TLNGHGGQGVIWLKTLPQGHQLLSQGRDLRLCLWDLEEGRNTIMDSVQLDSVGFCRGSIL
VRGQQCWMLAVPGKGSDEVQILEMPSKTSVCTLKPEADARPGMPMCLGLWQTNSSLRPLL
LAGYEDGSVTLWDISERKVCSQITCHEEPVMGLDFDSQKAKGISGSAGKVLAVWSLDDQQ
SLQVKKTHELTNPGIAEVTIRPDHKILATAGWDHRIRVFHWRTMKPLAVLAFHSAPVYCV
AFAADGLLAAGSKDQRISIWSLYPCP
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcagccctgttcccaccaccgcctggtcccagatttgtcctccgaggcacacagtcg
gctgtgaacacgctccatttctgcccaccatcccaagctgcagggaacccacttctcttc
tcagggtctcagaatggcctagtacatatctggagcctacaaacaagaagaatagttacc
actctaaatggccatgggggccagggtgtaatctggctgaagacactgccacagggacac
cagctcctcagccagggtcgagacctgcggctgtgcctgtgggacctggaggagggcagg
aacaccatcatggactcagttcagctggacagtgtgggcttctgcaggggctccatcctg
gtcaggggacagcagtgctggatgcttgctgtgccagggaagggcagcgacgaggttcag
attctggagatgccatccaagacgtcagtgtgcaccctgaagccggaggccgatgccagg
ccaggcatgcccatgtgcctggggctgtggcagactaactccagtctccgccccctcctt
ctggctggctatgaggatggatcagtaaccctgtgggacatctcagagcggaaggtgtgc
agccaaatcacctgccatgaagagcctgtcatgggcctcgacttcgactctcagaaggcc
aagggcatctctggctctgctgggaaggtactggctgtctggagtctggacgatcagcag
tccctgcaggtgaagaagactcatgaactcaccaatcctggaattgccgaagtcaccatc
cggccagaccacaagatcttagccacagcaggctgggaccatcgcatccgtgtgtttcac
tggaggacaatgaaaccgttagctgttctggctttccacagcgctcctgtgtactgcgtg
gcctttgctgctgatggcttgcttgctgcggggtccaaggaccagcgtatcagcatctgg
tcactctacccctgcccatga

DBGET integrated database retrieval system