KEGG   Mus musculus (mouse): 13982Help
Entry
13982             CDS       T01002                                 

Gene name
Esr1, ER, ER-alpha, ERa, ERalpha, ESR, Estr, Estra, Nr3a1
Definition
(RefSeq) estrogen receptor 1 (alpha)
  KO
K08550  estrogen receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    13982 (Esr1)
   04917 Prolactin signaling pathway
    13982 (Esr1)
   04919 Thyroid hormone signaling pathway
    13982 (Esr1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    13982 (Esr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13982 (Esr1)
   05205 Proteoglycans in cancer
    13982 (Esr1)
  09162 Cancer: specific types
   05224 Breast cancer
    13982 (Esr1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    13982 (Esr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13982 (Esr1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    13982 (Esr1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    13982 (Esr1)
Nuclear receptors [BR:mmu03310]
 3. Estrogen like
  3A. Estrogen receptor
   13982 (Esr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Motif
Other DBs
NCBI-GeneID: 13982
NCBI-ProteinID: NP_001289460
MGI: 1352467
Ensembl: ENSMUSG00000019768
Vega: OTTMUSG00000020886
UniProt: P19785 E7FJU2
Position
10 A1; 10 2.03 cM
AA seq 599 aa AA seqDB search
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAY
EFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQ
LSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIM
ESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKS
CQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPL
VIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVH
MINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGK
CVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIH
RVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPL
YDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacccttcacaccaaagcctcgggaatggccttgctgcaccagatccaaggg
aacgagctggagcccctcaaccgcccgcagctcaagatgcccatggagagggccctgggc
gaggtatacgtggacaacagcaagcccactgtgttcaactaccccgagggcgccgcctac
gagttcaacgccgccgccgccgccgccgccgccgcctcggcgccggtctacggccagtcg
ggcatcgcctacggccccgggtcggaggcggccgccttcagtgccaacagcctgggggct
ttcccccagctcaacagcgtgtcgcctagcccgctgatgctgctgcacccgccgccgcag
ctgtctcctttcctgcacccgcacggccagcaggtgccctactacctggagaacgagccc
agcgcctacgccgtgcgcgacaccggccctcccgccttctacaggtctaattctgacaat
cgacgccagaatggccgagagagactgtccagcagtaacgagaaaggaaacatgatcatg
gagtctgccaaggagactcgctactgtgccgtgtgcaatgactatgcctctggctaccat
tatggggtctggtcctgcgaaggctgcaaggctttctttaagagaagcattcaaggacac
aatgactacatgtgtccagctacaaaccaatgcaccattgacaagaaccggaggaagagt
tgccaggcctgtcggctgcgcaagtgttacgaagtgggcatgatgaaaggcggcatacgg
aaagaccgccgaggagggagaatgttgaagcacaagcgtcagagagatgacttggaaggc
cgaaatgaaatgggtgcttcaggagacatgagggctgccaacctttggccaagccctctt
gtgattaagcacactaagaagaatagccctgccttgtccttgacagctgaccagatggtc
agtgccttgttggatgctgaaccgcccatgatctattctgaatatgatccttctagaccc
ttcagtgaagcctcaatgatgggcttattgaccaacctagcagatagggagctggttcat
atgatcaactgggcaaagagagtgccaggctttggggacttgaatctccatgatcaggtc
caccttctcgagtgtgcctggctggagattctgatgattggtctcgtctggcgctccatg
gaacacccggggaagctcctgtttgctcctaacttgctcctggacaggaatcaaggtaaa
tgtgtggaaggcatggtggagatctttgacatgttgctggctacgtcaagtcggttccgc
atgatgaacctgcagggagaagagtttgtgtgcctcaaatccatcattttgcttaattcc
ggagtgtacacgtttctgtccagcaccttgaagtctctggaagagaaggaccacatccac
cgtgtcctggacaagatcacagacactttgatccacctgatggccaaagctggcctgact
ctgcagcagcagcatcgccgcctagctcagctccttctcattctttcccatatccggcac
atgagtaacaaaggcatggagcatctctacaacatgaaatgcaagaacgttgtgcccctc
tatgacctgctcctggagatgttggatgcccaccgccttcatgccccagccagtcgcatg
ggagtgcccccagaggagcccagccagacccagctggccaccaccagctccacttcagca
cattccttacaaacctactacatacccccggaagcagagggcttccccaacacgatctga

DBGET integrated database retrieval system