KEGG   Mus musculus (mouse): 13984Help
Entry
13984             CDS       T01002                                 

Gene name
Esx1, Spx1
Definition
(RefSeq) extraembryonic, spermatogenesis, homeobox 1
  KO
K18491  homeobox protein ESX1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    13984 (Esx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13984 (Esx1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    13984 (Esx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 13984
NCBI-ProteinID: NP_031983
MGI: 1096388
Ensembl: ENSMUSG00000023443
Vega: OTTMUSG00000018836
UniProt: O88933
Position
X F1; X 59.1 cM
AA seq 382 aa AA seqDB search
MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAESETTFYSDFGA
SPKEEEVEMENSLFNSMFLEEANYQEPEGFEPSRGEAAAPVAEAPQAWNGNENLGGGFLE
SNAQLGEADAAPVRQSLMRPLMQPVAQSSPQPLPANPLQAPQQPEEQEEEEEEQPGEEQP
QQEPKPRRYRICFTPIQLQELEAFFQRVQYPDLFARVELARRLGLPEPRVQVWFQNRRAK
WRRLRRAQAFRNMVPVAMSPPVGVYLDDHYGPIPIVEVIWKCYPMVPRPMHPQMMPLPPR
PPPGFRMPPPFRPPPLPPFPWPPVPPDAHIPNAAREYNPFPFPFPFPFPFPNPFPNPNPN
PNPNPNPNPNPNQNFAGPRYRY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcacaaaaagtgcccctgctgctactgcactgacttgaagacctttgttgga
gcagtgaaggaggaaacacttcaggatccacagcctagcttgagctcaacgcttttggag
ggagcagactaccaggaaaacgcggaatctgaaacaactttctactccgactttggagcc
agcccgaaggaggaagaagtggagatggagaactctctgttcaactccatgtttctggaa
gaagcaaactaccaggaacccgagggattcgaaccctcaagaggagaagcagcagcgccg
gttgcagaagcaccgcaagcctggaatgggaatgaaaaccttggaggcggcttcctggag
tccaacgctcagctgggggaggcggatgccgcccctgtgcggcagtccctgatgcgtcct
ctgatgcagcctgttgctcagtcttcgccgcaacccctgcccgcaaacccgctgcaggcc
ccgcagcagcccgaggagcaggaggaggaggaggaggagcagccgggggaggagcaaccc
caacaggagccgaagcctcgccgctaccgcatctgcttcaccccgatccaactgcaggag
ctggaggcctttttccagcgcgtccagtacccggacctgtttgctagagtggagcttgcc
cgacgcctgggcttacctgaacctagagtgcaggtttggtttcagaacagaagggccaag
tggagacgacttcggcgggcacaggcattcagaaacatggttccagtcgccatgagtccc
cctgtgggtgtctatcttgatgatcattatggccccatccctattgtggaggttatttgg
aagtgctacccaatggtgcctcgtcccatgcatcctcaaatgatgcctcttccacccagg
ccccctccaggattcagaatgcctccaccatttaggccacctcctctgccaccttttccc
tggccacctgtaccacctgatgcgcacatacccaatgcagcaagggaatataaccccttc
cccttccccttcccctttccctttcccttccccaacccattccccaaccccaaccctaac
cccaaccccaaccccaaccccaaccccaaccccaaccaaaattttgcaggtcccagatac
agatactga

DBGET integrated database retrieval system