KEGG   Mus musculus (mouse): 14004Help
Entry
14004             CDS       T01002                                 

Gene name
Chchd2, AL033347, Etohi6
Definition
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 2
  KO
K22758  coiled-coil-helix-coiled-coil-helix domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14004 (Chchd2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Other transcription factors
   Others
    14004 (Chchd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHCH DUF2076 Cmc1
Motif
Other DBs
NCBI-GeneID: 14004
NCBI-ProteinID: NP_077128
MGI: 1261428
Ensembl: ENSMUSG00000070493
Vega: OTTMUSG00000024020
UniProt: Q9D1L0
Position
5; 5 G1.3
AA seq 153 aa AA seqDB search
MPRGSRSRTSRVTPPASRAPQMRAAPRRAPAAQPPAAAAPSAVGSPAAAPRQPGLMAQMA
TTAAGVAVGSAVGHTLGHAITGGFSGGGSAEPAKPDITYQEPQGAQLQNQQSFGPCSLEI
KQFLECAQNQSDVKLCEGFNEVLRQCRIANGLM
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtggaagccgaagccgcacttcccgggtgactcctccggccagccgggcccct
cagatgagggctgctccccgaagagcacctgcagctcagcctccagcagcagctgcgcca
tctgcagttggctcacctgccgctgcgccccggcagccaggcctgatggcccagatggct
accaccgcggccggtgtggctgtgggctctgcagtgggacacaccctgggtcacgccatc
actgggggcttcagcggaggtggcagtgctgagcccgcaaagcccgacatcacttaccag
gagcctcagggagcccagctgcagaaccagcagtcttttggaccttgctctctagagatc
aagcagtttctggagtgtgctcagaaccagagcgatgtcaagctctgtgagggcttcaac
gaggtgctgcggcagtgcaggattgcaaatggtttaatgtaa

DBGET integrated database retrieval system