KEGG   Mus musculus (house mouse): 14007
Entry
14007             CDS       T01002                                 
Symbol
Celf2, B230218O03, B230345P09Rik, C88023, CELF-2, CUG-BP2, Cugbp2, D230046B21Rik, Etr-3, Napor, Napor-2, mETR-3
Name
(RefSeq) CUGBP, Elav-like family member 2
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    14007 (Celf2)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    14007 (Celf2)
SSDB
Motif
Pfam: RRM_1 RNA_bind RRM_7
Other DBs
NCBI-GeneID: 14007
NCBI-ProteinID: NP_001103700
MGI: 1338822
Ensembl: ENSMUSG00000002107
UniProt: Q9Z0H4
Position
2:complement(6544505..7401345)
AA seq 520 aa
MVSLISDLDSLRGWKALRETATELSGSPPSNGTANKMNGALDHSDQPDPDAIKMFVGQIP
RSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKT
LPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPD
GLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQ
MQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAA
AAAAAQTSATSTNANPLSSTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGAT
VGLNNINALAGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQ
QQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGF
VSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggtttccctaatctctgacctggactccctgagaggctggaaagcgttaagagagact
gccacagagttatctggaagtccaccaagtaacggcacagccaacaagatgaacggagct
ttggatcattcagaccagccagacccagatgccattaagatgtttgtcggacagatccct
aggtcctggtcggaaaaggagctgaaagaactttttgagccttatggagctgtctaccag
atcaacgtcctccgggaccggagtcagaaccctccccagagtaaaggttgttgtttcgta
acattttatacaagaaaagctgcacttgaggcccagaatgcactgcacaatattaaaact
ttacctgggatgcatcatcccattcagatgaaacctgcagatagtgaaaagtcaaacgct
gtggaagacagaaaattgttcataggaatggtttccaagaaatgtaacgagaatgatatc
agagtgatgttttctccattcggtcagatagaagaatgccggattctccggggacctgat
gggctgagtcgaggctgtgcgtttgtcacattttctacaagggcaatggcacagaatgca
atcaaagccatgcatcagtctcagaccatggagggctgctcttcaccaatcgtggtgaag
tttgctgacactcagaaggacaaagagcaaaggcgcctccagcagcagcttgcacagcag
atgcaacagctcaacactgccacttgggggaacctaacaggactgggtggacttaccccg
cagtacctggcgcttctgcagcaggccacctcctccagcaacctgggtgcattcagtggc
attcagcaaatggctggcatgaatgctttacagttacagaatctggcaacactggctgct
gctgcagctgctgctcaaacctcagccaccagcaccaatgcaaaccctctgtctagcaca
agcagtgccctgggagccctcacaagccctgtggctgcttcaacccccaattccaccgct
ggtgcggccatgaattccttgacctctcttgggactctacaaggattggctggagccact
gtcggattgaataatattaatgcactagcaggtatggcggctctgaatggaggacttggc
gccacaggcttgacgaatggtacggctggcaccatggacgccctgacccaggcctactca
ggaattcagcagtatgcggcagctgcactgcccactttgtacagccagagcttgctgcaa
cagcagagtgctgcaggcagccagaaggaaggtccagagggggcaaacctctttatttac
caccttccacaggagtttggagaccaggacattctgcagatgttcatgccctttggaaat
gttatctctgctaaagtcttcattgacaaacagaccaatctgagcaagtgctttggtttt
gttagctatgacaatccagtctctgcacaagctgcaatccaggctatgaacggctttcag
atcggcatgaaacgcttgaaggtgcagctgaaacgctccaaaaacgacagcaaaccttac
tga

DBGET integrated database retrieval system