KEGG   Mus musculus (mouse): 14020Help
Entry
14020             CDS       T01002                                 

Gene name
Evi5, NB4S
Definition
(RefSeq) ecotropic viral integration site 5
  KO
K20242  ecotropic viral integration site 5 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14020 (Evi5)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    14020 (Evi5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC DUF1129
Motif
Other DBs
NCBI-GeneID: 14020
NCBI-ProteinID: NP_031990
MGI: 104736
Ensembl: ENSMUSG00000011831
Vega: OTTMUSG00000028964
UniProt: F8VPT6 Q3UYX4
Position
5 F; 5 52.23 cM
AA seq 809 aa AA seqDB search
MVTTKMTAAFRNPNRRQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSASLHTTS
SSTTLSTPTQSPSSPSKLSPDDLELLAKLEEQNRLIETDSKSLRSVNGSRRNSGSSLVSS
SSASSNLSHLEEDSWILWGRIVNEWDDVRKKKEKQVKELVRKGIPHHFRAIVWQLLCNAQ
SMTIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDRE
VGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQE
YLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLALL
QMNQAELMQLDMEGMLQHFQKVIPHQFDGGPEKLIQSAYQVKYNSKKMKKLEKEYTTIKT
KEMEEQGEIKRLRTENRLLKQRIETLEKHKCSSTYNEDFVLQLEKELVQARLSEAESQCA
LKEMQDKVLDIEKKNNSFPDENNIARLQEELIAVKLREAEAIMGLKELRQQVRTLEEHWQ
RHLARTSGRWKDPPKKNAVNELQDELMSIRLREAETQAEIREMKQRMMEMETQNQINSNQ
LRRAEQEVNSLQEKVCSLSVKNKGLLAQLSEAKRRQAEIECKNKEEVMAVRLREADSIAA
VAELQQHIAELEIQKEEGKLQGQLNRSDSNQYIRELKDQIAELTHELRCLKGQRDFSSRP
PFDGIHIVSHLIGDDELFHSSDEDFIDSSLQESAIGFPLHRKSGPMSLNPALADGSESEA
EDGMLGPQESDPEAPQKQPPQRESYSTTV
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atggttaccaccaaaatgactgctgcctttagaaaccctaataggagacaggtggcgaca
gacaaggtggcagaaaagctgagttctactctctcatgggtgaagaacacagtatcgcat
acagtcagtcagatggccagtcaggtggcaagtccatctgcctcactacacactacatcc
tcatctaccacactgtcaacaccaacacagtcaccatcttccccatcaaagttgagtcca
gacgacttagaactcctggctaagctggaggaacaaaacagattaatagagacagacagt
aagtctttaagatcagtgaatgggtcaagaagaaacagtggttcctctcttgtatcaagt
tcatcagcctccagcaacctcagccacctggaggaagactcttggattctctggggaaga
attgtgaatgaatgggatgatgtacgcaagaagaaagaaaagcaagtgaaggagcttgtt
cgtaaagggataccccatcacttcagagcaatagtgtggcaacttttatgtaatgcacag
agtatgacaattaaggaccagtattcagaactcctgaaaatgacttcaccttgtgaaaaa
ctgatacgaagggacattgctagaacttatccagaacacaacttttttaaggaaaaagat
agccttggacaggaggttttatttaatgtaatgaaggcatactccttagtggaccgtgag
gttggttactgtcagggcagtgctttcatcgttggattgttgctgatgcagatgccagaa
gaagaggctttttgtgtatttgttaaattaatgcaagactacagacttcgtgaactattt
aagccaagtatggcggaattgggcctttgtatgtaccagtttgaatgtatgatacaggag
tatcttccggaactctttgtacattttcaatctcagagttttcatacgtcaatgtatgca
tcatcctggttcctgacaatctttcttacaactttcccactaccaattgcgacaaggata
tttgacatctttatgtctgagggtttggaaatagtgtttcgagtaggattagcgcttctt
cagatgaatcaggcagaattaatgcaacttgacatggaagggatgttacagcactttcag
aaggtcattccacatcagtttgatggtggcccagaaaaattaatccagtcagcttaccaa
gtcaaatacaactcaaaaaaaatgaaaaaacttgaaaaagaatacactacaataaaaact
aaagaaatggaagaacaaggtgaaattaaaaggctacgcacagaaaataggcttttaaaa
cagcgcattgaaacattagaaaaacataaatgcagttccacctacaacgaagatttcgtg
ctgcagctggagaaggaattggttcaagccagactgagtgaagccgagtctcagtgtgca
ctgaaggagatgcaggataaagtgttggatatagagaagaagaacaactcatttcctgat
gagaataatattgcaaggcttcaggaggaactcatcgctgtgaagctgagggaagccgaa
gccattatgggtttgaaagaacttcgacagcaagtcagaaccttagaagagcactggcag
cgtcacttagctcgaacttctggaagatggaaagacccacccaagaaaaatgctgtgaat
gagttacaggatgagctgatgagcattcgccttagagaggcggaaacacaggcagaaata
agagagatgaagcaaaggatgatggaaatggagacacagaaccagatcaatagtaaccaa
cttcgaagagcggagcaagaggtgaacagtctgcaggagaaggtgtgctcgctgtctgtg
aagaacaagggcttgcttgcccagttaagtgaggcaaagcgcagacaggcagagattgaa
tgcaagaacaaggaggaagtcatggctgtgcggctccgggaagctgatagcatcgcggcc
gtggctgagctgcagcagcacattgctgagcttgaaatccagaaagaagagggcaagctc
caaggacagcttaacaggtctgactctaaccagtacattagggaactgaaggaccagata
gcagagctgactcatgagctcagatgcctaaaaggccagcgggacttctccagccgacct
ccttttgatggaatccacattgtcagccatctaataggagacgatgaattgttccactca
tcggatgaagattttatagatagttccttacaggaaagtgccattggttttcctttgcac
agaaaatctggcccaatgtctctgaatcctgctttggcagatggcagtgagagcgaagca
gaagacggtatgctgggacctcaggagagtgaccctgaggctccacagaagcagccccca
cagagagagtcctactcaactaccgtgtga

DBGET integrated database retrieval system