KEGG   Mus musculus (mouse): 14030Help
Entry
14030             CDS       T01002                                 

Gene name
Ewsr1, Ews, Ewsh
Definition
(RefSeq) Ewing sarcoma breakpoint region 1
  KO
K13209  RNA-binding protein EWS
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    14030 (Ewsr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    14030 (Ewsr1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    14030 (Ewsr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RanBP RRM_1
Motif
Other DBs
NCBI-GeneID: 14030
NCBI-ProteinID: NP_031994
MGI: 99960
Ensembl: ENSMUSG00000009079
Vega: OTTMUSG00000005079
UniProt: Q61545
Position
11; 11 A1
AA seq 655 aa AA seqDB search
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYSTPTAPQAYSQPVQGYGTGTYDSTTATVTTTQASYAAQTAYGT
QPAYPTYGQQPTATAPTRPQDGNKPAETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSSQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSLSGPDNR
GRGRGGFDRGGMSRGGRGGGRGGLGAGERGGFNKPGGPMDEGPDLDLGLPIDPDEDSDNS
AIYVQGLNDNVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPP
TAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGMPPREGRGMPPPLRGGPGGPGGPG
GPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECN
QCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRG
GRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacggattacagtacctatagtcaagctgcagcccagcagggctacagtgct
tacaccgcccagccaactcaaggatatgcacagaccacccaggcatatgggcaacaaagc
tatggaacctatggacagcctactgatgtcagctatactcaggctcagaccactgccacc
tacgggcagactgcatatgcaacttcttacggacagcctcccactggttatagcactcca
actgccccgcaggcgtacagccagcctgtgcagggatatggcactgggacttatgacagc
accactgctacagtcaccacaacgcaggcctcttacgcagctcagactgcatatggcacc
cagcctgcctaccccacctatggccagcagccaacagccaccgcacctaccagaccacag
gatggtaacaagcctgctgagactagtcaacctcaatctagcacagggggttataaccaa
cccagcctaggatatggacagagtaactacagctatccccaggtacctgggagctaccca
atgcagccagtcaccgcacctccatcttatcctcctaccagctactcctcttcacagccg
actagttacgatcagagcagttactctcagcagaacacctatgggcagccgagcagctat
ggacaacagagtagctatggtcaacaaagcagctatgggcagcagcctcctactagttac
ccccctcagactggatcctacagccaggctccaagtcaatatagccaacagagcagcagc
tacgggcagcagagttcattccgacaggaccaccccagtagcatgggtgtttatgggcag
gagtctggaggattttccggaccaggagagaaccggagcttgagtggccctgataaccgg
ggcaggggaagagggggatttgatcgtggaggcatgagcagaggtgggcggggaggagga
cgcggtggactgggcgctggagagcgaggtggcttcaataagcctggtggacccatggat
gaaggaccagatcttgatctaggccttcctatagatcccgatgaagactctgacaacagt
gcaatttatgtgcaaggattaaatgacaatgtgactctggatgatctggcagacttcttt
aagcagtgtggggttgtcaagatgaacaagagaactggacaacccatgatccatatctac
ctggataaggagacaggaaagcctaaaggggacgccacagtgtcctatgaagatccacca
actgcaaaggctgccgtggaatggtttgatgggaaagattttcaaggaagcaaacttaaa
gtgtctcttgcccgaaagaagcctccaatgaacagcatgcggggaggcatgccacctcgt
gagggcagggggatgccaccaccacttcgtggaggtcctggtggcccaggaggccctgga
ggacccatgggtcgcatgggaggccgtggaggagacagagggggcttccctccaagaggg
ccccgaggctccagaggaaacccctctggaggaggaaatgtccagcaccgagctggagac
tggcagtgtcccaatccgggctgtggaaaccagaacttcgcttggagaacagaatgcaac
cagtgtaaggcccctaagcccgagggcttcctcccgccaccctttccacctccgggtggt
gatcgtggacgaggtggccctggtggcatgcgaggaggaagaggaggactcatggaccgt
ggtggtcctggaggaatgttcagaggtggcagaggtggagacagaggaggcttccgaggt
ggccgtggaatggaccgaggtggctttggtggaggaagacgaggtggtcctggggggcct
cctggacctttaatggaacagatgggaggaagaagaggcggacgtggaggacctgggaaa
atggataaaggcgagcaccgtcaggaacgcagagaccggccctactag

DBGET integrated database retrieval system