KEGG   Mus musculus (mouse): 14043Help
Entry
14043             CDS       T01002                                 

Gene name
Ext2, AI893565
Definition
(RefSeq) exostoses (multiple) 2
  KO
K02367  glucuronyl/N-acetylglucosaminyl transferase EXT2 [EC:2.4.1.224 2.4.1.225]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
mmu01100  Metabolic pathways
Module
mmu_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    14043 (Ext2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    14043 (Ext2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.224  glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
     14043 (Ext2)
    2.4.1.225  N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase
     14043 (Ext2)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   14043 (Ext2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_64 Exostosin
Motif
Other DBs
NCBI-GeneID: 14043
NCBI-ProteinID: NP_034293
MGI: 108050
Ensembl: ENSMUSG00000027198
Vega: OTTMUSG00000014564
UniProt: P70428 Q3UDB5
Position
2 E1; 2 51.62 cM
AA seq 718 aa AA seqDB search
MCASVKSNIRGPALIPRMKTKHRIYYVTLFSIVLLGLIATGMFQFWPHSIESSSDGGVEK
RSIREVPVVRLPTDSPIPERGDLSCRMHTCFDVYRCGFNPKNKIKVYIYPLKKYVDDAGV
PVSSAISREYNELLTAISDSDYYTDDINRACLFVPSIDVLNQNPLRIKETAQALAQLSRW
DRGTNHLLFNMLPGAPPDYNTALDVPRDRALLAGGGFSTWTYRQGYDVSIPVFSPLSAEM
ALPEKAPGPRRYFLLSSQMAIHPEYREELEALQAKHQESVLVLDKCTNLSEGVLSVRKRC
HQHQVFDYPQVLQEATFCTVLRGARLGQAVLSDVLQAGCVPVVIADSYILPFSEVLDWKR
ASVVVPEEKMSDVYSILQNIPQRQIEEMQRQARWFWEAYFQSIKAIALATLQIINDRIYP
YAAISYEEWNDPPAVKWASVSNPLFLPLIPPQSQGFTAIVLTYDRVESLFRVITEVSKVP
SLSKLLVVWNNQNKNPPEESLWPKIRVPLKVVRTAENKLSNRFFPYDEIETEAVLAIDDD
IIMLTSDELQFGYEVWREFPDRLVGYPGRLHLWDHEMNKWKYESEWTNEVSMVLTGAAFY
HKYFNYLYTYKMPGDIKNWVDTHMNCEDIAMNFLVANVTGKAVIKVTPRKKFKCPECTAI
DGLSLDQTHMVERSECINKFASVFGTMPLKVVEHRADPVLYKDDFPEKLKSFPNIGSL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcgtcagtcaagtccaacatccggggtcccgccctcatcccaaggatgaagacc
aagcaccgaatctactacgtcaccctgttctccatcgtcctcctgggcctcatagccacg
ggcatgtttcagttctggcctcactccattgagtcctccagtgatgggggtgtggagaaa
cgcagcatcagggaggtgcccgtggtcaggctgcccactgacagccccatcccagagcgg
ggggatctcagctgtagaatgcatacgtgtttcgatgtctaccgctgcggcttcaaccca
aagaacaaaatcaaggtgtacatctaccccctaaaaaagtatgtggatgatgccggtgtt
ccggtgagcagcgccatctcccgggagtacaatgaactgctgacggccatctcagacagc
gactactacacagacgacatcaaccgggcctgtctgttcgtcccctccattgacgtacta
aaccagaacccccttcgaataaaggagacggcgcaggccctggcccagctttccaggtgg
gatcgaggaacaaatcacctgctgttcaatatgttgcctggagctcccccagattacaac
actgccctggatgtccccagagacagggcactgctggctggtggcggcttttctacctgg
acttaccggcagggctacgatgtcagcattcctgttttcagcccactgtcagctgagatg
gctctcccagagaaagcaccaggtccccggcgctacttcctactgtcctctcagatggcc
atccaccctgagtacagagaggaactagaagccctccaggccaaacaccaagagtcagtg
ttagtcttggacaaatgcaccaatctctcggagggcgtcctgtccgtgcgaaagcgctgc
caccagcaccaggtcttcgattacccccaagtgctgcaggaggctactttttgtacggtc
cttcgaggagctcggctgggccaggcggtgctgagcgatgtcctacaggctggctgtgtc
ccagttgtcattgcagactcttatattctgcctttctctgaagttctggactggaagagg
gcatctgtggtcgttccagaggaaaagatgtcagatgtgtacagcatcctgcagaacatc
ccacagaggcagattgaagagatgcagagacaggcacggtggttctgggaggcatacttc
cagtccattaaagccattgccctggccaccctacagatcatcaatgacaggatctatcca
tatgcagccatctcctatgaagagtggaatgaccctcctgctgtgaagtgggctagtgtg
agcaacccgctcttcctgccgctgatcccacctcagtcccaaggcttcactgccatcgtc
ctcacctacgaccgcgtggagagcctcttccgggtcatcaccgaggtgtccaaggtgccc
agtctgtccaagctgctggtggtctggaataatcagaataaaaaccctccggaagaatct
ctgtggcccaaaatccgagttcccctgaaggttgtgaggactgcagaaaacaagctaagt
aatcgtttcttcccttacgacgaaatcgagacagaggccgtgctggccatcgatgacgac
atcatcatgctgacctctgacgagctgcagtttggttatgaggtctggcgggaatttccc
gaccgcctggtgggctacccaggccgcctgcatctctgggaccacgagatgaacaagtgg
aagtatgagtctgaatggaccaatgaggtgtccatggtgctcacgggcgcagccttctat
cacaagtattttaattacctgtacacctacaaaatgcctggagacatcaagaactgggtg
gatactcacatgaactgtgaagatattgccatgaattttctggtggccaatgtcacaggg
aaagctgtcatcaaggtaaccccaaggaagaagttcaagtgtcctgagtgcacggccatc
gacgggctctccctagaccagactcacatggtagagagatctgagtgcatcaacaagttt
gcttccgtcttcggaacgatgcccctcaaggtggtggagcaccgagcggaccctgtcctc
tacaaagatgacttccccgagaaactgaagagcttccccaacattggcagcttatga

DBGET integrated database retrieval system