KEGG   Mus musculus (mouse): 140474Help
Entry
140474            CDS       T01002                                 

Gene name
Muc4, 4933405I11Rik, Asgp
Definition
(RefSeq) mucin 4
  KO
K22017  mucin-4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    140474 (Muc4)
Membrane trafficking [BR:mmu04131]
 Others
  Mucins
   Membrane bound mucins
    140474 (Muc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWD NIDO EGF
Motif
Other DBs
NCBI-GeneID: 140474
NCBI-ProteinID: NP_536705
MGI: 2153525
Ensembl: ENSMUSG00000079620
UniProt: E9Q7Q0
Position
16; 16 B3
AA seq 3470 aa AA seqDB search
MRGPHWRVPWLCLSCLYSCLLLLPDALATTSTQTPMSLSSSTRTSQMSSQASTSSTSSDR
RTSKTEQTSTRDTPSSITTVSQSHHTTSMETSKPQTTTTTEVTTSTPSASSRDQIQTETS
SQRTISPDGTTTSHAPSISSSAPSTTHMLTTTSSTESTSVDSGHTTAITTQGLTPATAQV
SLTPSSQNMSTVSTPITSTLTQRQHTGSKQTSSKSQVNIVTSTLSTSTSDSTPAQTMSQV
TSSSDKRTKPSTSGVSSTSLTTTEVLTQTSSTDSAPGNTTLRITQNSTTHTTKVSTTSTP
QKLSPVSTLINSSQKMSTLPQNQHTESMDTSRQPQTTTTIEVTTSTPSASSLHQIQTETN
SPKTISPGETTTSHAPNMRSSPPKTSQILTTMPSTKSTSVDTKQTKAITTKVSTPDTTQV
SMTPSSQKLPTHSTSTQELTSSYSQHIQSKGTSSKSQTTTNTKVNTSTPSASSRDKIQTE
TSSQRTNSPGEKRTSHAPSMSSSAPSTTHMLSTTSSNQSTSVDTGQTTSVTAQGSTPAIT
QTSLTPSSQNTSTVSTPITSTHKLSTLSQSQHTGSKGTSSNPQTTTTTEVTTSTPSATTH
DQIQTETSSQNTISPGETTTSYAPIMSSSAPSTTHMLSTTSSTQSTSVDTRHTTTLTNQG
STPATTQVSPSSQNMSTVSAPITSTQILSTFPQSQHTGSKGTSSNPQTTTTPVVTTSNPS
ATSRDQIQTETSSQRTISPGETTTSYASIMSSSAPSTTHMLTTTSSTQSTSVDTRHTIAV
RTQGSTPATTQVSPSSQNMSTVSTPITSTQILSTLPQSQHTGSKGTSSNPQTTTSPVVTT
STPSGTSGDQIQTETSSQRTISPGKTTTSHALNINSSAPSTTHMLSTTSSTQSTSGDTRH
TTAGRTQGSTPATTQVSPSSQNMSTVSAPITSIQMLSTLPQSQHTESKSTSTNPQTTTTP
EVTTSNPSATSHDQIETETSSQRTISPGETTTSYAPIMSSSAPSTTHMLSTTSSTQSTSV
DTRNTTTLTTQGSTPATTQVSPSSKNMSTVSTPITSTHKLSTLPQSQHTGSNGTSSSSST
PATHRSHLHPNMSTVSTPITTTHKLSTLSQSQHTGSKGTSSNPQTTTTPVMTTSTPSATT
HDQIQTETSSQRTISHGETTTSYAPIMSSSAPSTTHMLSTASSTQITSVDTRHTTAITTQ
GSTPATTQVSPSSQNMSTVSAPITSIQILSTLPQSQHTGSKGTSTNPQTTTTPEVTTSTP
SATSRDQIQTETSSQRTISPGETTTSHAPIMSSSAPSTTHMLSTTSSTQSTSVDTRHTTA
GRTQGSTPATTQVSPSSQNMTTTSHALMSSSAPSTTHMLSTTSSTQSTSVDTRHTTTVTT
QGSTPATTQVLPSSQNMSTVSAPITSTQILSTLPQSQHTGSKGTSTNPQTTTNAEVTTST
PSATSHDQIETETSSQRTISPGETTTSHAPNMSSSAPSTTHMLSSTSSTQITSVDTGHTS
AGRTQGSTPATTQVSPSSQNMSTVSAPITSTHILSTLPKSQHTGSKGTSSNPQTTITPVV
TTSTPSASSRDQIQTETSFQRTISPGETTTSHAPSMSSSAPSSTHMLSTASSTQITSVDT
RHTTAITTQGSTPATTQVSPSSQNMSTVSAPITSIQMLSTLPQSQHTESKSTSTNPQTTT
TPRVTTSTPSASSRDQIQTETSSQRTISPGKTTTSHVPNMNSSAPSTTHILSTTSSIQST
SGDTRHTTAVRTQGSTPATTQVSLAPSSQNMSTLSAPITSPQHFSTLPQNQHTGSMGTSS
NPQSTTIPEVTTSTLSASSRDQVQTETSSQRTISPGETTTSHASSLSSSAPSSTHMLSTA
SSTEITSGDTRHTTAIVTQGSTPATTQTTLTPSSQNMSTVSTPITSTHKLSPLPQSQHTE
NMGTSSNPQTTTTPEVTTSTPSATSYDQIQTETSFQRTISPGETTTSHAPSMSNSAPSST
HKLSTASSTEITSVDTRHTIAITTQGSTLATTQTSLTPSSQNMSTVSAPITSSQILSTLR
QSQHTGSKGTSSNHQTTTTPVVTTSTSSATSRDQIQTETSSLRTISPDGTTTSHASSMSS
SSPNTTHLLITTSSTESTSVDTGYSTVITTHGSTLATTQVSLTPSSQNMSTVSMPSTSSQ
ELTSLPQRQHTGNMETSSQPQNITPTVVTTSTLLSFSRGSTELQTMSWGTSSSGTINTLS
TPVRNTSPASTSGILTSTLTTSGNTGYTGVTRSLGVITSRVTSTSLPGKSTVVHSTPAQP
LSAHSQSHQTYGTGTPSMSQTSILPDMTSEKRVASSPGPTVTESFSHVSSSSGLTTKTDN
DRNTAVSATSSTLTSPSPTTASRSTVPLPSLLPDQGISLFPYGSEVGDQNLFARTVDFNS
PIFKILIGFPLGSSLRDSFYVTDNGQIIFPESDYDVFSYPNPPQRGFTGRERVAMVAPFW
ADADFSSSRGAIFYQEYVTFYNEHHQLIREVETLINDFTSSWGYRAKWTLKVTWVNVPAY
TAQESFGTNTYQAILSTDGSRSYALFLYQNSGMRWDVTQEPYNRVLMGFSSGDGYFENSP
LTFRPAMEKYRPDRFLNSKLGIRGLQVYRLHREERPNYRLKCLQWLESQPQQPSWGWSSV
SCPCSWQQGQRDFRFRPINPGWWDRQLCSFSSGRGGVCCSYGAWGEFREGWRMHSPWQFD
EEQEAQNWCCQWNDKPSFCVWYQLRRPRVSCAGYRPPRPAWTFGDPHITTLDNANFTFNG
LGDFLLVQAQDRNSSFLLEGRTAQTGTAKATNFIAFAAQYNTSSLKSPITVQWFLEPSDK
IRVVYNNQTVAFNTRDTEVLPIFNTTGVLLTQNGSQVSANFDGTVTISVIARSNILHASS
SLSEEYRNHTEGLLGVWNDNPEDDFRMPNGSTIPSNSSEETLFYYGMTWHVNGTGLLGIR
ADPLPTKFTPIFLSQLLNQSASGEDLASGCKGDRKCMFDILATGNRTIGQSTNSILNEFQ
HMNDTLNQYPPSINCSSKIQAYKGQTVTTEITSNSKDATLSLSKKCSGFKLFENGSLQWT
PTSPEACTLEILARDVRTNLSWVLQPKTVACFCSKEEQCLYNETSKEGNSSLEVTSCKCD
GDTFGRLCERSKDPCDEPCFPNVNCIPGKGCEACPPNTTGDGRHCAALEDSCPNRSCPMN
YCYNNGHCDISEAPGCQPTCTCPPAFTDNRCFLAGNSFTPTISMELPLRTIVLSLREDEN
ASAADVNASVANILENLDMRAFFSNSLVELIRTSPGAQPSSKSIHHWKVTSHFKYRPRGP
LIHYLNNQLIGAVMEAFLLQARQERQKRSGEARKDVHFFPISRADVQDQMALNLSMLEEY
FTCDGYKGYHLVYSPQDGVTCVSPCSEGYCHNGGQCKHLPDGPQCSCASFTIYSSSGEHC
EHLSVKLGAFYGILFGTLGALLLLGILAFMIFHFCGCSKNKFSYPLDSEL
NT seq 10413 nt NT seq  +upstreamnt  +downstreamnt
atgagagggcctcactggagagttccctggctgtgtctgagctgcctgtattcttgcctc
ctcttgctacctgatgctctagcaacaacatcaacacagacacccatgtccctttccagc
agcaccagaacatcccaaatgagctcacaagcatcgacctcatcaacatcttctgacaga
aggacaagtaaaacagaacaaacatcaacaagggatactccaagttccataacaacagtt
tctcagagccatcatactacaagcatggagaccagcaaacctcaaaccaccacaaccacc
gaggtgaccacatcaactccttcagcctcctcacgtgaccaaatacagacagagacaagt
tctcaaagaacaatctctcctgatggaacaaccacctcacatgctcccagtatcagcagc
tcagctccaagtacaacacacatgttaaccacaacatcctccacagaaagtacctcagta
gactcaggacacacaacagcaataacaactcaaggtttaacacctgccaccgcacaagtc
tcactgacaccttcatcccagaatatgtcaacagtgtcaacacccatcacctcaactctt
actcagagacaacacactggaagcaagcagaccagcagcaaatctcaagtcaacatagtc
acatcaactctttcaacctctacaagtgactcaactcctgcacagacaatgtctcaagtg
acatcatcttcagataaaagaaccaagccatctacttctggtgtcagcagtacatcacta
actacaacagaagtgctcacccaaacatcctctacagactctgctccaggaaacacaact
ctgaggattactcagaactctacaacacataccacgaaagtctcaacaacatctacacca
caaaaactgtcaccagtgtcaacactcatcaattcaagtcaaaaaatgtcaacccttcct
cagaaccaacacactgaaagcatggacaccagcagacaacctcaaaccaccacaaccata
gaggtgaccacatcaaccccttcagcctcctcacttcaccaaattcagacagagacaaat
tccccaaaaacaatctctcctggtgagacaaccacctcacatgctccgaacatgagaagc
tcaccaccaaagacatcacagatactaaccacaatgccctccacaaaaagtacctcagta
gacacaaaacaaacaaaggcaataactactaaagtttctacacctgacaccacacaggtc
tcgatgacaccttcatcccagaaattgccaacacacagcacgtctactcaggaattaaca
tcttcttacagccaacatattcaaagcaaggggaccagcagcaaatctcaaacaaccaca
aacaccaaggtgaacacatcaactccttcagcctcctcacgtgacaaaattcagacagag
acaagttcccaaagaacaaactctcctggcgagaaaaggacatcacatgctcccagcatg
agcagctcagctccaagtacaacacacatgttatccacaacatcctccaatcaaagtacc
tcagtagacacaggacaaacaacatcagtaacagctcaaggttctacacctgccatcaca
cagacctcattgacaccttcatcccagaatacgtcaacagtgtcaacacccatcacctct
actcacaaattgtcaaccctttctcagagccaacacactggaagcaaggggaccagcagc
aatcctcaaactaccaccaccacagaggtgaccacatcaactccttcagccaccacccat
gaccaaattcagacagagacaagttcccaaaacacaatctctcctggtgagacaaccacc
tcatatgctcccatcatgagcagctcagctccaagtacaacacatatgttatccacaaca
tcctccactcaaagtacctcagtagacacaagacacactacaacattaacgaatcaagga
tctacacctgccaccacacaggtctcaccttcatcccagaacatgtcaacagtgtcagca
cccatcacctcaactcaaattttgtcaacctttcctcagagccaacacactggaagcaag
gggaccagcagcaatcctcaaactaccaccaccccagtggtgaccacatcaaatccttca
gccacctcacgtgaccaaattcagacagagacaagttcccaaagaacaatctctcctggt
gagacaaccacctcatatgcttccatcatgagcagctcagctccaagtacaacacacatg
ttaaccacaacatcctccactcaaagtacctcagtagacacaagacacacaatagcagta
aggactcaaggttctacacctgccaccacacaggtctcaccttcatcccagaacatgtca
acagtgtcaacacccatcacctcaactcaaattttgtcaacccttcctcagagccaacac
actggaagcaaggggaccagcagcaatcctcaaactaccacaagcccagtggtaaccaca
tcaactccttcaggcacctcaggtgaccaaattcagacagagacaagttcccaaagaaca
atctctcccggcaagacaaccacttcacatgctctcaacataaacagctcagctccaagt
acaacacacatgttatccacaacatcctccactcaaagtacctcaggagacacaagacac
acaacagcaggaaggactcaaggttctacacctgccaccacacaggtctcaccttcatcc
cagaacatgtcaacagtgtcagcacccatcacctcaattcaaatgttgtcaacccttcct
cagagccaacacactgaaagcaagagtaccagcaccaatcctcaaactaccaccacccca
gaggtgaccacatcaaatccttcagccacctcacatgaccaaattgagacagaaacaagt
tcccaaagaacaatctctcctggtgagacaaccacctcatatgctcccatcatgagcagc
tcagctccaagtacaacacacatgttatccacaacatcctccactcaaagtacctcagta
gacacaagaaacactacaacattaacgactcaaggatctacacctgccaccacacaggtc
tcaccttcatccaagaacatgtcaacagtgtcaacaccaatcacctctactcacaaattg
tcaacccttcctcagagccaacacactggaagcaatgggaccagcagctcaagttctaca
cctgccacacacaggtctcaccttcatcccaacatgtcaacagtgtcaacacccatcacc
actactcacaaattgtcaaccctttctcagagccaacacactggaagcaaggggaccagc
agcaatcctcaaactaccacaacgccagtgatgaccacatcaactccttcagccaccacc
catgaccaaattcagacagagacaagttctcaaagaacaatctctcatggtgagacaacc
acctcatatgctcccatcatgagcagctcagctccaagtacaacacacatgttatcaaca
gcatcctctactcaaattacctcagtagacacaagacacacaacagcaataacaactcaa
ggttctacacctgccaccacacaggtctcaccttcatcccagaacatgtcaacagtgtca
gcacccatcacctcaattcaaattttgtcaacccttcctcagagccaacacactggaagc
aaggggaccagcaccaatcctcaaactaccaccaccccagaggtgaccacatcaactcct
tcagccacctcacgtgaccaaattcagacagagacaagttcccaaagaacaatctctcct
ggtgagacaaccacctcacatgctcccatcatgagcagctcagctccaagtacaacacac
atgttatccacaacatcctccactcaaagtacctcagtagacacaagacacacaacagca
ggaaggactcaaggttctacacctgccaccacacaggtctcaccttcctcccagaacatg
acaaccacctcacatgccctcatgagcagctcagctccaagtacaacacacatgttatcc
acaacatcttccactcaaagtacctcagtagatacaagacacactacaacagtaacgact
caaggttctacacctgccaccacacaggtcttaccttcatcccagaacatgtcaacagtg
tcagctcccatcacctcaactcaaattttgtcaacccttcctcagagccaacacactgga
agcaaggggaccagcaccaatcctcaaactaccaccaatgcagaggtgaccacatcaact
ccttcagccacctcacatgaccaaattgagacagaaacaagttcccaaagaacaatctct
cctggtgagacaaccacctcacatgctcccaacatgagtagttcagctccaagtacaaca
cacatgttatcctcaacatcctccactcaaattacctcagtagacacaggacacacatca
gcaggaaggactcaaggttctacacctgccaccacacaggtctcaccttcatcccagaac
atgtcaacagtgtcagcacccatcacctcaactcatattttgtcaacccttccaaagagc
caacacactggaagcaaggggaccagcagcaatcctcaaactaccataaccccagtggta
accacatcaactccttcagcctcctcccgtgaccaaattcagacagagactagtttccaa
agaacaatctctcctggcgagacaaccacctcacatgctcccagcatgagcagctcagct
ccaagttcaacacacatgttatcaacagcatcctctactcaaattacctcagtagacaca
agacacacaacagcaataacaactcaaggttctacacctgccaccacacaggtctcacct
tcatcccagaacatgtcaacagtgtcagcacccatcacctcaattcaaatgttgtcaacc
cttcctcagagccaacacactgaaagcaagagtaccagcaccaatcctcaaactaccacc
acccccagagtgaccacatcaactccttcagcctcctcacgtgaccaaattcagacagag
acaagttcccaaagaacaatctctcccggcaagacaaccacctcacatgttcccaacatg
aacagctcagctccaagtacaacacacatcttatccacaacatcctccattcaaagtacc
tcaggagatacaagacacacaacagcagtaaggactcaaggttctacacctgccaccaca
caggtctcactggcaccttcatcccagaacatgtcaacactgtcagcacccatcacatca
cctcaacatttttcaacccttcctcagaaccaacacactggaagcatggggaccagcagc
aatcctcaaagtaccaccatcccagaggtgaccacatcaactctttcagcttcctcacgt
gaccaagttcagacagagacaagttcccaaagaacaatctctcctggtgagacaaccacc
tcacatgcttccagcttgagcagttcagctccaagttcaacacacatgttatccacagca
tcctccactgaaattacctcaggagacacaagacacacaacagcaatagtgactcaaggt
tctacacctgccaccacacagaccacattgacaccttcgtcccagaatatgtcaacagtg
tcaacacccatcacttctactcacaaattgtcaccccttcctcagagccaacacactgaa
aacatggggaccagcagcaatcctcaaactaccaccaccccagaagtgaccacatcaact
ccttcagccacctcctatgaccaaattcagacagagacaagtttccaaagaacaatctct
cctggtgagacaaccacttcacatgctcccagcatgagcaactcagctccaagttcaaca
cacaagttatcaacagcatcctccactgaaattacctcagtagacacaagacacacaata
gcaataacgactcaaggttctacacttgccaccacacagacctcactgacaccttcatcc
cagaacatgtcaacagtgtcagcacccatcacctcatctcaaattttgtcaactcttcgt
cagagccaacacactggaagcaaggggaccagcagcaatcatcagactaccactacccct
gtggtgaccacatcaacttcttcagccacctcacgtgaccaaattcagacagagacaagt
tccctaagaacaatctctcctgatggaacgaccacctcacatgcttccagcatgagcagt
tcatctccaaatacaacacacttgttaatcactacatcctccacagaaagtacctcagta
gacacaggatactcaacagtaataacgactcatggttctacacttgccaccacccaggtc
tcattgacaccttcatcccagaatatgtcaacagtgtcaatgcccagcacttcttcacag
gaattaacatcacttcctcagagacaacacactggaaacatggagaccagcagccaacct
cagaatatcacccctactgtggtgaccacatcaactcttttatcattctcaaggggatcc
actgaattgcaaaccatgtcttggggaacgtcctcctcagggacaataaataccctatct
actcccgtcaggaatacctcacctgcatccacatcaggcatcctcaccagcacattgacc
acctcaggaaacacagggtacacaggtgtaactagaagcctcggtgtgatcacatcaaga
gtcacaagcacaagtctacctggaaagtccacagtagtgcatagcacccctgctcagcca
ttgtctgcacattctcagagtcaccagacgtatggcacggggacacccagcatgtctcaa
accagcatcctcccagacatgacctcagaaaagcgtgttgcctcttcacctggacccact
gtgacagagtccttttctcatgtgtcatcctcctcaggattgactacgaagacagacaat
gacagaaacacagcagtctcagccacctcctcgacccttactagccccagcccaaccaca
gcctccaggtcaacagtgcccctgccttctcttttaccagatcagggcatttccctcttc
ccctacgggtctgaagtcggagaccagaatttgtttgccaggactgtggattttaactca
ccaatcttcaagatcctgattggctttcccctcggttcctccctgcgggattccttctac
gttacagataatggtcagatcattttcccagagtcagactatgacgtcttctcctacccc
aacccacctcaaagaggcttcaccggaagggagcgcgtggccatggtggccccgttctgg
gctgatgctgatttctctagctccaggggagccatattttaccaggaatatgtcacattt
tacaatgaacaccatcagctaatccgggaagtggagactttgattaatgatttcacaagt
agctggggctacagagccaagtggacactgaaggtcacctgggtcaatgttcctgcctat
actgcccaagagagctttgggaccaatacctaccaagccatcctctccacagatgggagc
aggtcctatgccctgtttctctaccagaacagtggcatgaggtgggatgtgacccaggaa
ccatacaaccgggtgctcatgggcttctccagtggagatgggtattttgaaaacagcccg
ctgacattccggccagcaatggagaagtaccgtccagatcgattcctgaattccaaatta
ggcatccggggactgcaggtctacaggctgcacagggaggagcggcccaactaccggctc
aaatgtctgcagtggctggagagtcagcctcagcagcccagctggggctggagctcagtt
tcctgcccttgctcctggcagcagggacaacgggactttcggttcaggcccatcaaccca
ggttggtgggacaggcagctgtgcagcttctcctccgggcgagggggtgtgtgctgcagc
tatggtgcctggggagagtttcgagaaggctggagaatgcacagtccttggcagtttgat
gaggagcaggaggcacagaactggtgctgccaatggaacgacaagccctcgttctgtgtc
tggtaccagcttaggcggccccgtgtcagctgtgctgggtacaggcccccacggcccgct
tggacatttggtgatccccacatcaccactttggataatgccaacttcaccttcaacggg
ctgggagactttctgctggtccaggcccaggacagaaattcttccttcctgctggaaggc
cgcactgcccagactggcactgccaaggccactaacttcattgcctttgcggctcaatac
aacaccagcagcctgaagtctcccatcacggttcagtggtttcttgagcccagtgacaaa
atccgagtcgtatacaataaccagactgtggcctttaacaccagagacactgaagtctta
cccatattcaataccaccggtgttctgctgacccaaaatggctcccaagtctcagccaac
tttgatgggacagtgactatctctgtgattgctcgctccaacatccttcatgcctcctcc
agcctatcagaggaatatcgaaaccacacagagggccttctgggagtgtggaatgacaat
ccagaagatgacttcaggatgcccaatggctccaccattccctcaaacagctctgaggag
acccttttctactatggaatgacatggcacgtcaacggaacaggcctccttgggataagg
gcagacccgctgcctaccaagttcacccccatctttctgtctcaactgttgaatcagagt
gcctcaggtgaagacttggcctctgggtgcaaaggcgacagaaagtgcatgtttgacatc
ctggccacgggaaacagaactattggacaaagcaccaattccatccttaatgagttccaa
catatgaatgacaccctcaatcagtacccaccctctatcaactgcagcagcaagattcaa
gcctacaaggggcagacagtgaccactgagatcaccagcaactctaaggatgccacactc
agcctctccaagaaatgtagtggctttaagctctttgaaaacgggagtttgcagtggaca
ccaacatccccagaagcgtgtaccctggagattctagcgagggatgtcaggactaacttg
tcatgggtactccagcccaagaccgtggcttgcttctgcagtaaggaggagcagtgtttg
tacaatgaaaccagcaaagagggcaattcttcccttgaggtgaccagctgcaagtgtgat
ggggacacctttggccgcttgtgtgaacgctccaaggacccgtgtgatgagccatgcttc
cctaacgtgaactgcattcctgggaagggctgtgaggcctgccctccaaacacaactgga
gatggacgtcattgtgcagctctggaggactcctgcccaaaccgttcctgtcccatgaat
tactgctataacaatggccattgcgacatctctgaggctccaggctgccagcccacttgc
acctgtccccctgccttcactgataaccgctgcttcctggctgggaacagtttcactccc
accatctctatggagcttcccttaaggaccatcgtgctctctctcagggaggatgaaaat
gcctccgccgctgacgtcaacgcctcggtggcgaacatactagagaacctggacatgcgg
gcttttttctccaacagcttagtggaactgatacgaacctctcccggagcacagccctcg
agcaagtccattcatcactggaaggtcacctcccacttcaagtaccgtcccaggggcccg
ctcatccactatctgaacaaccagctgataggcgccgtgatggaggccttcctcctgcag
gctcggcaggagaggcagaagaggagtggagaagccaggaaggacgtccacttcttcccc
atctcgagggcagatgtccaggaccagatggctctgaacctaagtatgctggaggagtac
ttcacatgtgatggctacaaaggctaccacctggtctacagcccacaggatggtgtcacc
tgtgtgtccccatgtagtgagggctactgtcacaatggaggccaatgcaagcacctgcca
gatgggccccaatgcagctgcgcatccttcaccatctactcatcctcgggcgaacactgt
gagcacctaagtgtgaaacttggggcattctacgggatcctcttcggaaccctgggcgcc
ctcttgctactggggatcttagcatttatgatctttcacttctgcggctgctccaagaac
aagttctcctaccctttggactcagaattgtaa

DBGET integrated database retrieval system