KEGG   Mus musculus (mouse): 140481
Entry
140481            CDS       T01002                                 

Gene name
Man2a2, 1700052O22Rik, 4931438M07Rik, AI480988, MX, Man_IIx
Definition
(RefSeq) mannosidase 2, alpha 2
  KO
K01231  alpha-mannosidase II [EC:3.2.1.114]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    140481 (Man2a2)
   00513 Various types of N-glycan biosynthesis
    140481 (Man2a2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.114  mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
     140481 (Man2a2)
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Other DBs
NCBI-GeneID: 140481
NCBI-ProteinID: NP_766491
MGI: 2150656
Ensembl: ENSMUSG00000038886
Vega: OTTMUSG00000058665
UniProt: Q8BRK9 Q197W7 Q7TPQ0
Position
7; 7 D2
AA seq 1152 aa
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPARHQNGGNFPRSQISVLQNRIEQLEQL
LEENHDIISRIKDSVLELTANAEGPPALLPYHTANGSWAVLPEPRPSFFSVSPQDCQFAL
GGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWDTEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYL
LRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDSSTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKSRLFRSNVLL
VPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQAQFGTLSEYFDALYKRTGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEILYSLALAHAR
RSGLAGQYPLSDFALLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQVII
NAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHDALPERTVIRLDSSPRFVVVFNPLEQER
LSVVSLLVNSPRVRVLSEEGQPLSVQISVHWSSATDMVPDVYQVSVPVRLPGLGLGVLQL
QPDLDGPYTLQSSVRVYLNGVKLSVSRQSAFPVRVVDSGASDFAISNRYMQVWFSGLTGL
LKSIRRVDEEQEQQMELEFLVYGTRTSKDKSGAYLFLPDSEAKPYVPKKPPVLRVTEGPF
FSEVAVYYEHFHQVIRLYNLPGVEGLSLDMSFQVDIRDYVNKELALRIHTDIDSQGTFFT
DLNGFQIQPRQYLKKLPLQANFYPMPVMAYIQDSQRRLTLHTAQALGVSSLGNGQLEVIL
DRRLMQDDNRGLGQGLKDNKITCNRFRLLLERRTTMSPEVHQEQERSTSYPSLLSHLTSM
YLSTPPLVLPVAKRQGTSPALRSFHPLASPLPCDFHLLNLRMLPAEDTLPATDSALILHR
KGFDCGLEAKNLGFNCTTSQGKLALGSLFHGLDVTFLQPTSLTLLYPLASPSNSTDISLE
PMEISTFRLRLG
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgaagctgaaaaagcaggtgacggtgtgtggggctgctatcttctgtgtggccgtcttt
tctctgtaccttatgctggaccgagtgcagcatgatcctgccagacaccagaatggtggg
aacttccccaggagccaaatctctgtgctacagaaccggatagaacagctggaacaactg
ctggaggaaaaccatgacatcataagccgtatcaaggactctgtactggaactgacagcc
aatgcggagggcccgccagccctgctgccctaccataccgccaacggttcctgggctgtg
ctcccggagccccggcccagcttcttctccgtctccccccaggactgccagtttgctttg
gggggacggggtcagaagccagaactacagatgttaaccgtgtctgaggatttgccgttt
gacaatgtggagggtggcgtgtggaggcaaggctttgacatctcctacagcccaaatgac
tgggacactgaagacctgcaagtgtttgtggtgcctcactcccacaacgatccaggctgg
atcaagacttttgacaagtactacacggaacagacccagcacatcctcaacagcatggtg
tccaagctgcaggaagacccccggcggcgctttctctgggcagaagtctccttcttcgcc
aagtggtgggacaacatcagtgcccaaaagagggcagcagttcgaaggctggtgggaaat
gggcagctggagattgcgacaggcggatgggtgatgcccgacgaggccaactcccattac
tttgccttggttgaccagctcatcgaggggcaccagtggctggagagaaacctgggtgca
accccgcgctcgggctgggcagtggacccctttggacacagctccaccatgccttacctg
ctgcgccgtgccaacctgaccagcatgctgattcagagggtgcattatgccatcaagaag
cactttgctgccactcatagcctggagttcatgtggaggcagatgtgggattcagactcc
agcacagacatcttttgccacatgatgcccttctacagctacgacgttccacacacctgt
ggccccgatcccaagatctgctgccagtttgatttcaaacgtctgccgggtgggagaatc
aattgcccttggaaggtgccaccccgggctattacagaagccaatgtggcagacagggca
gccctgctcctggaccagtaccggaagaagtcccggctgttccgaagcaacgtcctcctc
gtgccacttggtgatgacttccggtatgacaagccccaggaatgggatgcccagttcttc
aactaccagcggctctttgacttcctcaacagcaagcctgagttccatgtgcaggcccag
tttgggaccctctctgagtatttcgatgccctgtataagaggacaggagtagagcctggt
gcccggcctccagggtttcctgtgctgagtggggacttcttctcctacgctgaccgggag
gaccactactggacaggctattacacctcccggcctttctacaagagcttggaccgcgtc
ctagaagcccacctgcgtggggcagagattctatacagcctggctttggcccatgcccgc
cgttctggactggccggccagtacccgctgtctgattttgctcttctgacggaagctcgg
cgtacactgggcctcttccagcaccacgatgccatcacgggaaccgccaaggaggcagta
gtggtagactacggggtcaggttgctgcgttccctggtcagcctcaagcaggttatcatc
aatgctgcccactacctggtgctgggggaccaggagacctacagctttgaccctgggaca
cccttcctccaaatggatgacagccgtgtaagccatgatgccctgcccgagcgcacggtg
atccggctggactcctcacccaggtttgtggtggtatttaacccgctggaacaggagcgg
ctcagtgtggtgtccctgctggtcaactcgccccgggtgcgcgtcctttcagaggagggc
cagcccctgtctgtgcagatcagtgtgcactggagctcggctacggacatggtccctgat
gtctaccaggtgtcagtacccgtccgcctgccaggcctgggcctgggtgtgctgcagctg
cagccagatctcgatgggccctacacgctgcagtcttccgtgcgggtctacctgaacggc
gtgaaactgtccgtcagcaggcagtcagcattccctgtccgtgttgtggactccggcgcc
agcgacttcgccatcagcaatcgctacatgcaggtctggttctccggccttactgggctt
ctcaagagcatccgacgggtggatgaggagcaggagcagcagatggaactggagttcctc
gtctacggcacccgtacctccaaggacaagagtggcgcctacctcttcctgcctgatagc
gaggctaagccctacgtccctaagaaacctcctgtgctgcgtgtcaccgaaggccctttc
ttctcagaggtggctgtgtactatgagcactttcaccaagtgattcgactttataacctg
ccaggggtagaggggctgtctctggacatgtcattccaggtagatatcagggactatgtg
aacaaggaactggccctgcgcatccacacagacattgacagccagggcactttcttcaca
gacctcaatggctttcagatacagccccggcagtatctgaagaagctgcccctgcaggct
aatttctaccctatgccagtcatggcctatatccaagattcccagaggcgcctcacgctg
cacactgcccaggctctgggtgtctccagcctcggtaatggccagctggaggtgatcttg
gaccgaaggctaatgcaggatgacaaccggggactaggccaagggctcaaagacaacaag
atcacctgcaaccgtttccgcctcctgttagaacgtcggaccacaatgagcccagaggtg
catcaggagcaggagcgttctacaagctacccgtccctcctcagccacctgacatccatg
tacctcagcacacctcctcttgtcttacccgtggccaagaggcagggcactagccctgct
ctgcgctctttccaccctctggcttctccattgccctgtgacttccatttgctcaatctg
cgcatgctcccagccgaggacaccttgcccgcaactgactctgcgctcatcttacaccgc
aaggggtttgactgtggccttgaagccaagaacctgggcttcaactgtaccacaagccaa
ggcaagctagccctggggagcctcttccatggcctggatgtgaccttcctgcagccaacc
tccttgactttgctataccctctggcctcaccttccaacagcactgacatctctctggag
cccatggagatcagcaccttccgcctgcgcttgggctag

DBGET integrated database retrieval system