KEGG   Mus musculus (mouse): 140482
Entry
140482            CDS       T01002                                 

Gene name
Zfp358, Zfen, Zfend
Definition
(RefSeq) zinc finger protein 358
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-Di19 zf-C2H2_6 Zn-ribbon_8 zinc_ribbon_15 zf_UBZ GAGA Zn_ribbon_SprT FYVE zf-C2HC_2 DZR zf-H2C2_5
Other DBs
NCBI-GeneID: 140482
NCBI-ProteinID: NP_536709
MGI: 2153740
Ensembl: ENSMUSG00000047264
Vega: OTTMUSG00000059165
UniProt: E9Q8M1
Position
8 A1.1; 8 1.92 cM
AA seq 571 aa
MRRSVLVRNPGHKNLRPLYGDLHSDPEDLDSSPKDPDPISESPEPEPEDLNTVSEDGDAS
LEDLDPEADEAPRSILGKPDLDSQDLDPMSSSFDLDPDPDVIGPVPLVLDPSNDTPSPAA
PDVDSLPSGLTATPEILATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEK
PYRCPDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKHRSSHSGEKPHHC
PVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCG
KAFGQSSALLQHQRTHTAERPYRCPHCGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFG
QSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHEGAAAAAAAAAAAAAAAAAA
AGLGLGSGLSPVSMMRPGQISFLGPDAVSVLESGLGLSSGASSARSSAPTSVLGSLQNPI
LQTHSGSISSPDLVLSSDPKPGHVADPDVVPSPDQESDPSPNPDLVPSPDPKPKSQTDPC
SPTHDSSSPALPTGESPKWVKEEGALLGPDG
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgaggcgctcagttctggttaggaatccgggccataagaatcttaggcccctttatgga
gaccttcactcagacccagaagacctggactccagtcccaaagatcctgatcctatttct
gaaagccctgagccagagccagaagacctcaacactgtctcagaagatggagacgccagc
ttagaagatctggaccctgaagcagacgaagctccacgatccatcttggggaagccagac
ttggattcccaagatctggatcccatgtcttcgagtttcgacctcgatcctgatcctgac
gtgattggcccggtgccactagttctcgacccaagcaatgacacccccagccctgctgct
ccagatgtggattcccttccttctggcctcactgccacccccgaaatcttggccaccagt
ccagcggtgcttcctgcccctgccagtccacctcgtccgttctcttgtcctgattgtggg
cgagccttccgtcgcagctctgggctgagccagcaccgacgcacacacagtggagagaag
ccttaccgctgtcccgactgtggcaagtcattcagccatggcgccacactggcccagcat
cgtggcatccacacaggtgcacggccctaccagtgtgctgcctgcggcaaggcctttggc
tggcgatccacactgctcaagcatcgaagcagccacagtggggagaagccacaccactgt
cccgtgtgtggcaaggccttcggtcatggctcgttgctggcccaacacctgcgcacgcac
ggcggccctcgtccccacaagtgcccagtgtgtgccaaaggctttgggcagggctctgcg
ctacttaaacacctgcgcacccacacaggcgagcgtccctacccatgcccgcagtgcggc
aaggcctttgggcagagctcagcgttgctccagcatcagcgcacccacactgctgagcgt
ccctaccgctgtccccactgtggcaaagcctttgggcagagctccaacttgcagcaccac
ctccgaatccacactggtgagcgaccttatgcctgcccacactgctccaaggcctttggg
cagagttcagcactcctacaacacctccacgtgcattctggcgagcgcccctaccgttgt
cagctctgtggcaaagcctttggccaagcctccagcctcaccaaacataagcgtgtgcat
gagggagctgcagcagccgccgccgctgctgctgctgccgccgctgcagcggccgcagca
gctgggctgggcctcgggtctggtttgagcccagtatctatgatgaggccagggcagatc
tctttcctgggtcctgatgctgtttctgtgctggaatctggcctgggcctcagttctgga
gccagctctgcccgaagttctgcccctacttctgtactgggttcactccaaaatcccatc
cttcagacccactcaggatctatctctagtcccgatcttgttttgtcttctgaccctaag
ccaggccatgttgctgatcctgatgtggtacccagtcctgaccaagaatctgatcccagc
cctaaccccgatcttgtccccagtcctgaccccaaacccaagtcccaaactgacccctgc
tctccgactcacgacagttccagcccagcccttccaactggagaaagtcccaagtgggta
aaggaggaaggggcattgctggggcctgatggataa

DBGET integrated database retrieval system