KEGG   Mus musculus (house mouse): 140488
Entry
140488            CDS       T01002                                 
Symbol
Igf2bp3, 2610101N11Rik, IMP-3, IMP3, Koc13, Neilsen, mimp3
Name
(RefSeq) insulin-like growth factor 2 mRNA binding protein 3
  KO
K13197  insulin-like growth factor 2 mRNA-binding protein 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    140488 (Igf2bp3)
   03041 Spliceosome [BR:mmu03041]
    140488 (Igf2bp3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     140488 (Igf2bp3)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    140488 (Igf2bp3)
SSDB
Motif
Pfam: KH_1 KH_2 KH_4 RRM_1 MOEP19 KH_5
Other DBs
NCBI-GeneID: 140488
NCBI-ProteinID: NP_076159
MGI: 1890359
Ensembl: ENSMUSG00000029814
UniProt: Q9CPN8
Position
6:complement(49062152..49200225)
AA seq 579 aa
MNKLYIGNLSDHAGPADLESVFKDAKIPVAGPFLVKTGYAFVDCPDEGWALKAIEALSGK
MELHGKPMEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETA
VVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDETAAQQNPSPQLRGRRGPGQRGSS
RQASPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENTGAA
EKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK
KIEQDTDTKITISPLQELTLYNPERTITVKGSVETCAKAEEEIMKKIRESYENDIASMNL
QAHLIPGLNLNALGLFPPTSGMPPPTSGPPSTLTPPYPQFEQSETETVHLFIPALSVGAI
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFV
SPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQSLSSAEVVVPRDQTPDENDQVVVKIT
GHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgaacaaattgtacatcgggaacctcagcgaccacgccggccccgcggacctggaaagt
gtcttcaaggacgctaagatcccggtggcgggccccttcctggtgaagacgggctacgcg
ttcgtggactgcccggacgagggctgggccctcaaggccatcgaggcgctttcaggtaaa
atggaactacatgggaaaccgatggaagttgagcactcggtccctaaacggcagaggatt
cgtaaacttcagatacgaaatatcccgccccacttacaatgggaggtgctggatagttta
ctagtccagtatggagtggtggagagctgtgagcaagtgaacacggattcggaaacggca
gttgtaaatgtaacctattccagtaaggaccaagctagacaagccttagacaaactgaat
ggattccagttagagaacttcaccttgaaggttgcctacatcccagatgaaactgctgcc
cagcaaaatccctcgccacagctccgggggcgccgggggccagggcagcggggctcatcc
aggcaggcgtctccaggatcggtgtccaagcagaaaccctgtgacctgccactgcgcctg
ctggttcccacccagtttgttggagccattataggaaaagaaggtgctaccattcgcaac
atcacaaagcagacccagtctaaaatcgatgtccatcgtaaggagaatacaggggccgcg
gagaagtccattactatcctctctacccctgaaggcacctctgcagcttgtaagtctatt
ctggagattatgcataaggaagctcaagatataaaattcacagaggagattcccttgaag
atcttagctcacaataactttgtaggccgtctcattggtaaagaaggaagaaaccttaaa
aaaatcgagcaagacacggacactaaaatcacaatatctccattgcaggaactgacgctg
tacaatccggaacgcaccattacagtgaaaggcagtgttgagacgtgtgccaaggcggag
gaggaaataatgaagaagatcagggagtcttatgaaaatgatattgcttccatgaatctt
caagcacatttaatccctggattaaatctgaatgccttgggtctgttcccacccacgtca
gggatgccacctcccacctcagggcccccttcaaccctgactcctccctacccacaattt
gagcaatcagagacggagactgtgcatctgtttattcccgccctgtccgttggcgccatc
attggcaagcagggccaacacatcaaacagctttctcgctttgcgggagcttcgattaag
atcgctccagccgaagcaccagatgctaaagtgcggatggtgattatcactggaccacca
gaggctcagttcaaggctcagggaagaatttatggaaaaattaaagaagaaaactttgtt
agtcctaaagaagaggtgaaacttgaagctcacatcagagtgccgtcctttgctgctggc
agagttattgggaaaggaggcaaaacggtgaatgagctccagagtttatcaagtgctgaa
gttgtcgtcccccgtgaccagacacctgatgagaatgatcaagtagttgtcaaaataact
ggccacttctatgcttgccaggttgcccagaggaaaattcaggaaattctgactcaggta
aagcagcaccagcagcagaaagctctgcagagtggaccacctcagtcaaggcggaagtaa

DBGET integrated database retrieval system