KEGG   Mus musculus (mouse): 140489Help
Entry
140489            CDS       T01002                                 

Gene name
Bhlhe23, A930001L02Rik, BETA4, Beta3b, Bhlhb4
Definition
(RefSeq) basic helix-loop-helix family, member e23
  KO
K09086  class B basic helix-loop-helix protein 4/5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    140489 (Bhlhe23)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Pancreatic factors
    140489 (Bhlhe23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Dynactin_p22
Motif
Other DBs
NCBI-GeneID: 140489
NCBI-ProteinID: NP_542372
MGI: 2153710
Ensembl: ENSMUSG00000045493
Vega: OTTMUSG00000016272
UniProt: Q8BGW3 Q0VEJ8
Position
2 H4; 2 103.34 cM
AA seq 223 aa AA seqDB search
MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAAPASRVPAATV
ESSGEQSGDEDEAFERRRRRRGSGVAVDARRRPREQRSLRLSINARERRRMHDLNDALDG
LRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQGLAAPVAAAP
LTPFGQAAIYPFSAGTALGPCPDKCATFSGSPSALCKHCGEKP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctcaagtcgctgtcgggggactcgtacctggcgctgagccacagctacacg
gcgaccggccacgcctacgctgcagcgcgcggaccggagaccacacgcggcttcggtgca
tcgggtccgggtggcgacctcccggcggctcccgcttctcgtgtccccgccgcgacggtg
gagagcagcggcgagcagagcggcgacgaggacgaagccttcgagaggcggcggcggcgg
cgagggtccggggttgcggttgacgcacggcggcggccccgggagcagcgctcgctgagg
ctcagcatcaacgcgcgcgaacggcgacgcatgcatgacctgaacgacgcgctggacgga
ctgcgcgcagtcatcccctacgcgcacagcccgtcggtgcgcaagctctccaagatagcc
acacttctgctggccaaaaactacatcctcatgcaggcgcaggccctggaggagatgcgg
cgcttggtagcatacctcaaccaaggccagggcctcgcggcgccggtggccgccgcgcct
ctaacgccctttggccaggcagcgatttacccgttctcggcgggcaccgcgctcgggccc
tgcccagacaagtgtgccaccttctcaggatcgccctcggcgctttgcaaacactgcggc
gagaagccctga

DBGET integrated database retrieval system