KEGG   Mus musculus (mouse): 14049
Entry
14049             CDS       T01002                                 

Symbol
Eya2, Eab1
Name
(RefSeq) EYA transcriptional coactivator and phosphatase 2
  KO
K17620  eyes absent homolog 2 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    14049 (Eya2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     14049 (Eya2)
Protein phosphatases and associated proteins [BR:mmu01009]
 HAD phosphatases
  EYAs
   14049 (Eya2)
SSDB
Motif
Pfam: Hydrolase
Other DBs
NCBI-GeneID: 14049
NCBI-ProteinID: NP_001258891
MGI: 109341
Ensembl: ENSMUSG00000017897
Vega: OTTMUSG00000001181
UniProt: O08575 Q3UV00
Position
2 H3; 2 85.83 cM
AA seq 532 aa
MLEVVTSPSLATSSDWSEHGAAVGTLSDREGIAKSAALSVPQLFVKSHPRVPPGQSSTAM
AAYGQTQYSTGIQQAPPYTAYPTPAQAYGIPPYSIKTEDSLNHSPSQSGFLSYGPSFSTA
PAGQSPYTYPVHSTAGLYQGANGLTNTAGFGSVHQDYPSYPSFSQNQYPQYFSPSYNPPY
VPASSLCSSPLSTSTYVLQEAPHNVPSQSSESLAGDYNTHNGPSTPAKEGDTERPHRASD
GKLRGRSKRNSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGL
MMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSTDGFHSTAPGASLCL
GTGVHGGVDWMRKLAFRYRRVKEMYNTYRNNVGGLIGAPKRETWLQLRAELEALTDLWLT
HSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFER
IMQRFGRKAVYIVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgttagaagtggtgacctcacccagcctcgcaacaagcagtgactggagcgagcacggt
gctgccgtggggacgctgagtgacagggaaggcatcgccaaatcagcggctctgagtgtg
cctcagctctttgtgaagtctcatccacgtgtccctcctggtcagtcctccacagccatg
gcggcctatggccagacacagtacagcacaggcattcagcaggcaccaccctatacagcg
tacccaactccggcgcaagcctatggaatccccccttacagcatcaagacagaagacagt
ttgaatcactcccccagccagagcgggttcctgagctatggaccgagcttcagcaccgcg
cctgctggacagagcccctacacctaccccgtgcacagcaccgctgggctctatcaaggc
gccaacggactgaccaacaccgctggatttgggagcgtgcaccaggattatccgtcctac
cccagcttttcacagaaccagtacccccagtatttcagcccatcatacaacccgccctac
gtccctgccagcagcctctgctcctcgcccctctccacgtccacctacgtcctccaggag
gctcctcacaatgtccccagccagagttctgagtccctggccggagactacaacacacac
aacggaccctccacaccagcaaaggagggtgacacagagaggccacatcgagcctcggat
gggaagctacggggccggtcaaagagaaatagtgacccttccccagcaggagacaatgaa
atcgagcgcgtgttcgtctgggacctggacgagacaatcattatcttccactccctgctc
acagggacgtttgcatccagatacgggaaggacaccacgacgtctgtgcgcattggcctg
atgatggaggagatgatcttcaaccttgctgacacacacctgttcttcaatgacctggag
gactgtgaccaaatccacgtggatgatgtctcatccgatgacaatggtcaggatttaagc
acatacaacttctccactgatggcttccacagcacggcgccaggagccagcttgtgcctg
ggtacaggtgttcatggcggtgtggactggatgaggaaactggccttccgctaccgtcgt
gtgaaggagatgtacaacacctaccgcaacaacgtgggtggcttgataggtgctcccaaa
agagagacctggctgcagctgcgcgccgagctggaggccctgactgacctctggctcacc
cactccctgaaagccctcaatctcatcaactctcgacccaactgtgtcaatgtgttggtc
accaccacgcaactgatccctgcattggccaaggtcctgctgtacggtctgggctccgtg
ttccccatcgagaacatctacagtgcgaccaagacaggcaaggagagctgcttcgaaaga
atcatgcagaggtttggccgcaaagctgtctacattgtgataggcgacggggtagaggaa
gagcaaggagccaaaaagcacaacatgcctttctggaggatatcctgtcatgctgacctg
gaggctctaaggcatgccctggaactggagtatctatag

DBGET integrated database retrieval system